DC900303

Overview
NameDC900303
Unique NameDC900303
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length658
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9730 contig Csv1_Contig9730:368..1036. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP28_ARATH (Probable aquaporin PIP2-8 OS=Arabidopsis thaliana GN=PIP2-8 PE=1 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.416e-102
Identity = 184/197 (93.40%), Postives = 188/197 (95.43%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPSN 592
            IFVLVYCTAGISGGHINPAVTFGLFLARKVSL RAVAYMVAQCLGAICGVGLVKAFM   Y  LGGGANTVA GY+ G+ALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL SFRSNP+N
Sbjct:   82 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFRSNPTN 278          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP27_ARATH (Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2)

HSP 1 Score: 370.163 bits (949), Expect = 5.381e-102
Identity = 179/197 (90.86%), Postives = 190/197 (96.45%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPSN 592
            IFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ YM+AQCLGAICGVG VKAFMK  YN+LGGGANTVA GY+KG+ALGAEIIGTFVLVYTVFSATDPKRSARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDD WIFWVGPF+GALAAAAYHQYILRA+AIKALGSFRSN +N
Sbjct:   84 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFRSNATN 280          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP1_ATRCA (Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 5.950e-101
Identity = 176/197 (89.34%), Postives = 186/197 (94.42%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPSN 592
            IFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ YM+AQC GAICGVGLVKAFMK  YN  GGGAN+VA GYNKG+A GAE+IGTFVLVYTVFSATDPKRSARDSHVP+LAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  + WDDHWIFWVGPFVGALAAAAYHQY+LRAAAIKALGSFRSNP+N
Sbjct:   86 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLLRALVYMIAQCAGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTAFGAELIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKKRVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKALGSFRSNPTN 282          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP26_ORYSJ (Probable aquaporin PIP2-6 OS=Oryza sativa subsp. japonica GN=PIP2-6 PE=2 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 2.116e-98
Identity = 174/197 (88.32%), Postives = 184/197 (93.40%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPSN 592
            IF+LVYCTAGISGGHINPAVTFGL LARKVS+IRAV Y+VAQCLG I GVG+VK  MKH+YN+ GGGAN VASGY+ G+ALGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYN  KAWDDHWIFW GPF+GALAAAAYHQYILRAAAIKALGSFRSNPSN
Sbjct:   86 IFILVYCTAGISGGHINPAVTFGLLLARKVSVIRAVMYIVAQCLGGIVGVGIVKGIMKHQYNANGGGANMVASGYSTGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFRSNPSN 282          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP27_MAIZE (Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.421e-94
Identity = 164/194 (84.54%), Postives = 175/194 (90.21%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 583
            IF+LVYCTAGISGGHINPAVTFGLFL RKVSL+RA+ YM+AQC GAICG GL K F K  YN  GGG NTV+ GYNKG+ALGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG AVI+NNDKAWDD WI+WVGPFVGA  AA YHQYILR +AIKALGSFRSN
Sbjct:   93 IFILVYCTAGISGGHINPAVTFGLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSN 286          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP21_ORYSJ (Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 5.394e-94
Identity = 166/194 (85.57%), Postives = 179/194 (92.27%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 583
            IF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGVGLVKAF    +N  GGGANT+A+GY+KG+ L AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+NN+KAW +HWIFWVGPFVGA  AA YHQYILRA AIKALGSFRSN
Sbjct:   96 IFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSIGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSN 289          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 9.200e-94
Identity = 166/194 (85.57%), Postives = 178/194 (91.75%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 583
            IFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ Y+VAQCLGAICGVGLVKAF    ++  GGGAN++ASGY++G+ LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIYN DK WDDHWIFWVGP VGA  AA YHQYILRA AIKALGSFRSN
Sbjct:   96 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALGSFRSN 289          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.569e-93
Identity = 163/194 (84.02%), Postives = 178/194 (91.75%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 583
            IFVLVYCTAGISGGHINPAVTFGLFLARKVSL+RA+ YMVAQCLGA+CGVGLVKAF    ++  GGGAN++ASGY++G+ LGAEI+GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+YN DK WDDHWIFWVGP +GA  AA YHQYILRA AIKALGSFRSN
Sbjct:   98 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAVCGVGLVKAFQSAYFDRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIKALGSFRSN 291          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 3.865e-92
Identity = 165/193 (85.49%), Postives = 173/193 (89.64%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRS 580
            IFVLVYCTAGISGGHINPAVT GLFLARKVSL+R V Y+VAQCLGAICG G VKAF    Y   GGGAN +A GYNKG+ LGAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNN+KAWDD WIFWVGP +GA AAA YHQ+ILRAAAIKALGSF S
Sbjct:   91 IFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFGS 283          
BLAST of DC900303 vs. ExPASy Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2)

HSP 1 Score: 336.265 bits (861), Expect = 8.611e-92
Identity = 162/193 (83.94%), Postives = 173/193 (89.64%), Query Frame = 2
Query:    2 IFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRS 580
            IF+LVYCTAGISGGHINPAVTFGLFLARKVSLIRAV YMVAQCLGAICGVG VKAF    Y+  GGGAN++A GYN G+ L AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  K WDDHWIFWVGPF+GA  AA YHQ++LRA+  K+LGSFRS
Sbjct:   89 IFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRS 281          
The following BLAST results are available for this feature:
BLAST of DC900303 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 193
Match NameE-valueIdentityDescription
PIP28_ARATH2.416e-10293.40Probable aquaporin PIP2-8 OS=Arabidopsis thaliana ... [more]
PIP27_ARATH5.381e-10290.86Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7... [more]
PIP1_ATRCA5.950e-10189.34Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1[more]
PIP26_ORYSJ2.116e-9888.32Probable aquaporin PIP2-6 OS=Oryza sativa subsp. j... [more]
PIP27_MAIZE2.421e-9484.54Aquaporin PIP2-7 OS=Zea mays GN=PIP2-7 PE=2 SV=1[more]
PIP21_ORYSJ5.394e-9485.57Probable aquaporin PIP2-1 OS=Oryza sativa subsp. j... [more]
PIP21_MAIZE9.200e-9485.57Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP22_MAIZE1.569e-9384.02Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP24_ARATH3.865e-9285.49Probable aquaporin PIP2-4 OS=Arabidopsis thaliana ... [more]
PIP22_ARATH8.611e-9283.94Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900303 VSS Citrus sinensis cDNA clone VS28652 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900303 ID=DC900303|Name=DC900303|organism=Citrus sinensis|type=EST|length=658bp
GATCTTCGTCCTTGTTTACTGCACCGCTGGCATTTCTGGTGGTCACATTA
ACCCTGCTGTGACGTTTGGGCTGTTCTTGGCAAGGAAGGTATCATTGATC
AGGGCTGTGGCTTACATGGTGGCTCAGTGCTTGGGTGCCATTTGCGGTGT
TGGTTTGGTCAAGGCCTTCATGAAGCATGAGTACAACTCACTTGGTGGTG
GTGCTAACACTGTGGCTTCTGGCTACAACAAAGGATCAGCCTTGGGTGCT
GAGATTATTGGTACCTTCGTGCTTGTTTACACAGTCTTCTCGGCCACAGA
CCCCAAGAGAAGCGCTCGTGACTCTCACGTGCCCGTTTTGGCTCCACTTC
CAATTGGATTTGCTGTGTTCATGGTTCACTTGGCCACCATCCCCATCACT
GGAACGGGCATCAACCCTGCTAGGAGCTTTGGTGCTGCTGTTATCTACAA
CAATGACAAGGCCTGGGATGACCATTGGATCTTCTGGGTTGGTCCTTTCG
TTGGAGCATTGGCTGCAGCGGCATACCACCAGTACATCTTGAGGGCTGCT
GCTATCAAGGCTTTGGGATCATTCCGCAGCAACCCTTCAAACTAAGAAAG
CAAATTATGATGAATATGAACCACCAACCAGAATAGCTNTTTCCTTTCTC
TCTTTCTG
back to top