DC900301

Overview
NameDC900301
Unique NameDC900301
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length828
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3636 contig Csv1_Contig3636:69..895. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: FHIT_DICDI (Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 9.123e-34
Identity = 55/101 (54.46%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  104 FGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSPAQSW 406
            FGP+ I   E+F++T LS+A+VNL+P+LPGHVLVC +R   R  DLT +E TDLWL+AQ++   +E +  G   TFAIQDG  AGQTV HVHIH  P + +
Sbjct:    6 FGPWLIRQSEIFFTTELSFALVNLKPVLPGHVLVCPKRIVPRVKDLTKEEFTDLWLSAQRISSVVEEHFNGDGITFAIQDGKNAGQTVEHVHIHIIPRKKF 106          

HSP 2 Score: 45.0542 bits (105), Expect = 9.123e-34
Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 3
Query:  387 VLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF 551
            ++PRK  DFE ND+IY+ IE             KER+ RS EEM +E+ + R LF
Sbjct:  100 IIPRKKFDFENNDQIYNEIE-------------KEREPRSYEEMEKESSELRPLF 141          
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: FHIT_BOVIN (Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=FHIT PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 8.146e-32
Identity = 51/102 (50.00%), Postives = 72/102 (70.59%), Query Frame = 2
Query:   98 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSPAQS 403
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF D++ +E  DL+  AQ+VG  +E + +G+S TF++QDGPEAGQTV HVH+H  P ++
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQAAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKA 104          

HSP 2 Score: 47.3654 bits (111), Expect = 8.146e-32
Identity = 27/55 (49.09%), Postives = 32/55 (58.18%), Query Frame = 3
Query:  387 VLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF 551
            +LPRKAGDF +ND IYDA+E  ++E     D D     RS EEM  EA   R  F
Sbjct:   99 ILPRKAGDFHRNDSIYDALEKHDRE-----DKDSPALWRSEEEMAAEAAALRVYF 148          
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: FHIT_RAT (Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus GN=Fhit PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.488e-30
Identity = 52/102 (50.98%), Postives = 70/102 (68.63%), Query Frame = 2
Query:   98 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSPAQS 403
            F FG + I    VF  T LS+A+VN +P++PGHVL+C  R  +RF DL  DE  DL+   Q+VG  +E + +G+S TF++QDGPEAGQTV HVH+H  P +S
Sbjct:    3 FKFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLMCPLRPVERFRDLRPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHILPRKS 104          

HSP 2 Score: 43.1282 bits (100), Expect = 1.488e-30
Identity = 23/55 (41.82%), Postives = 33/55 (60.00%), Query Frame = 3
Query:  387 VLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF 551
            +LPRK+GDF +ND IYD ++  ++E     + D     RS EEM  EA+  R+ F
Sbjct:   99 ILPRKSGDFRRNDNIYDELQKHDRE-----EEDSPAFWRSEEEMAAEAEVLRAYF 148          
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: FHIT_HUMAN (Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3)

HSP 1 Score: 112.464 bits (280), Expect = 1.940e-30
Identity = 53/102 (51.96%), Postives = 70/102 (68.63%), Query Frame = 2
Query:   98 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSPAQS 403
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF DL  DE  DL+ T Q+VG  +E +  G+S TF++QDGPEAGQTV HVH+H  P ++
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKA 104          

HSP 2 Score: 41.5874 bits (96), Expect = 1.940e-30
Identity = 25/55 (45.45%), Postives = 30/55 (54.55%), Query Frame = 3
Query:  387 VLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF 551
            VLPRKAGDF +ND IY+ ++  +KE       D     RS EEM  EA   R  F
Sbjct:   99 VLPRKAGDFHRNDSIYEELQKHDKE-------DFPASWRSEEEMAAEAAALRVYF 146          
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: FHIT_MOUSE (Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN=Fhit PE=2 SV=3)

HSP 1 Score: 111.309 bits (277), Expect = 3.286e-30
Identity = 52/102 (50.98%), Postives = 70/102 (68.63%), Query Frame = 2
Query:   98 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSPAQS 403
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF DL  DE  DL+   Q+VG  +E + +G+S TF++QDGPEAGQTV HVH+H  P ++
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKA 104          

HSP 2 Score: 41.9726 bits (97), Expect = 3.286e-30
Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 3
Query:  387 VLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF 551
            VLPRKAGDF +ND IYD ++  ++E     + D     RS +EM  EA+  R  F
Sbjct:   99 VLPRKAGDFPRNDNIYDELQKHDRE-----EEDSPAFWRSEKEMAAEAEALRVYF 148          
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: NFT1_CAEEL (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 7.603e-29
Identity = 53/107 (49.53%), Postives = 68/107 (63.55%), Query Frame = 2
Query:   83 SSTTQFTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSPAQS 403
            S T    F  + I A  +FYSTP S+  VNL+P+  GHVLV  +R   R  DLT  ET DL++ A+KV   LE +H  +STT  +QDG +AGQTVPHVHIH  P ++
Sbjct:  294 SETGGLKFARFNIPADHIFYSTPHSFVFVNLKPVTDGHVLVSPKRVVPRLTDLTDAETADLFIVAKKVQAMLEKHHNVTSTTICVQDGKDAGQTVPHVHIHILPRRA 400          

HSP 2 Score: 40.0466 bits (92), Expect = 7.603e-29
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 3
Query:  387 VLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSL 548
            +LPR+AGDF  N EIY  +   +KE         ERK RS E+M +EA  YR+L
Sbjct:  395 ILPRRAGDFGDN-EIYQKLASHDKE--------PERKPRSNEQMAEEAVVYRNL 439          
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: APH1_SCHPO (Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe GN=aph1 PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 2.932e-19
Identity = 48/100 (48.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:   95 QFTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSP 394
            Q  F  + + + +VFY T LS A VNL+P+LPGHVLV  +R   R  DLT  E TDL+ + +KV + +E     S++   IQDG +AGQTVPHVH+H  P
Sbjct:    4 QLYFSKFPVGS-QVFYRTKLSAAFVNLKPILPGHVLVIPQRAVPRLKDLTPSELTDLFTSVRKVQQVIEKVFSASASNIGIQDGVDAGQTVPHVHVHIIP 102          
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: HNT2_YEAST (Hit family protein 2 OS=Saccharomyces cerevisiae GN=HNT2 PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.506e-15
Identity = 40/90 (44.44%), Postives = 59/90 (65.56%), Query Frame = 2
Query:  128 KEVFYSTPLSYAMVNLRPLLPGHVLVCS-RREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSP 394
            ++VFY +  +YA+VNL+P++PGHVL+   R      +DLT  E+ D + T Q + + ++  +K  S   AIQDGPEAGQ+VPH+H H  P
Sbjct:   14 EQVFYKSKYTYALVNLKPIVPGHVLIVPLRTTVLNLSDLTMPESQDYFKTLQLIHRFIKWQYKADSINVAIQDGPEAGQSVPHLHTHIIP 103          
BLAST of DC900301 vs. ExPASy Swiss-Prot
Match: NFT1_DROME (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster GN=NitFhit PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.263e-14
Identity = 37/92 (40.22%), Postives = 54/92 (58.70%), Query Frame = 2
Query:  119 IDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHGSP 394
            +D + +FY +   +A  NLR ++ GHVLV ++R   R   L   E  D++ T   V + LE  ++ +S T  +QDG +AGQTVPHVH H  P
Sbjct:  323 VDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSATVTVQDGAQAGQTVPHVHFHIMP 414          
The following BLAST results are available for this feature:
BLAST of DC900301 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
FHIT_DICDI9.123e-3454.46Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium d... [more]
FHIT_BOVIN8.146e-3250.00Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=F... [more]
FHIT_RAT1.488e-3050.98Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegic... [more]
FHIT_HUMAN1.940e-3051.96Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN... [more]
FHIT_MOUSE3.286e-3050.98Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN... [more]
NFT1_CAEEL7.603e-2949.53Nitrilase and fragile histidine triad fusion prote... [more]
APH1_SCHPO2.932e-1948.00Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] ... [more]
HNT2_YEAST1.506e-1544.44Hit family protein 2 OS=Saccharomyces cerevisiae G... [more]
NFT1_DROME8.263e-1440.22Nitrilase and fragile histidine triad fusion prote... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900301 VSS Citrus sinensis cDNA clone VS28649 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900301 ID=DC900301|Name=DC900301|organism=Citrus sinensis|type=EST|length=828bp
ATTAAAACGGTGCCGCTCAATCTCCAGCACCACCATCACTCTCCCCAAGG
CAAGTAAAATCAAATCGGCCTCAGCTCAGATGTCGTCGACGACTCAGTTT
ACGTTCGGGCCTTACAAAATTGATGCGAAGGAAGTGTTCTATAGCACTCC
TCTCTCCTACGCCATGGTCAACCTGCGCCCGTTGCTTCCTGGTCATGTAC
TTGTCTGCTCGAGGCGTGAAGCAAAGCGCTTTGCTGATCTTACAGCTGAT
GAGACTACTGATTTATGGCTCACAGCCCAAAAGGTTGGCAAACAGCTCGA
AAGCTACCACAAGGGTTCATCAACAACATTTGCCATCCAAGATGGGCCTG
AAGCTGGACAGACAGTACCCCATGTTCACATCCATGGTTCTCCCGCGCAA
AGCTGGTGACTTTGAAAAAAATGATGAGATTTATGATGCAATAGAGGTGA
AGGAGAAGGAATTACAGCAGAAGCTTGATTTGGATAAGGAAAGGAAGGAC
AGAAGCCTCGAGGAGATGAATCAAGAGGCTGATCAATACAGGTCGCTTTT
CCTGTGAAAATTTAGCAGTGCCTTTCATTAGGCTTCTCTTGAACGTTCGC
CAAAGCTGCCAGAAACTTCAGGCCTCTAAATAAAATACTTCATGAAATTT
TATTAGTGTTTCTAAAAACATTGGGCTTTCATACAATTATTATACATCAT
ATCTCAGATACAGAATAATCCTTCGCCCATCCTCATCACTTGTTGAATTC
TGGAATTCCTACAATTCTAAGTTTGCTATATTCAGTTTGGAGCTATGTTT
ATTACTAATTTCATGATATATGTTTTAA
back to top