DC900300

Overview
NameDC900300
Unique NameDC900300
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length634
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1384 contig Csv1_Contig1384:801..1435. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S2_MOUSE (Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.465e-18
Identity = 40/87 (45.98%), Postives = 57/87 (65.52%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y HLC ED+ W W++F  SG  A+Y  +Y+I+Y    LQ ++G  S +LY GY++IM +   L TGTIGF   F+FV  ++S VK+D
Sbjct:  577 YFHLCAEDYHWQWRSFLTSGFTAVYFLIYAIHYFFSKLQ-ITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 662          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S2_RAT (Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.525e-18
Identity = 40/87 (45.98%), Postives = 57/87 (65.52%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y HLC ED+ W W++F  SG  A+Y  +Y+I+Y    LQ ++G  S +LY GY++IM +   L TGTIGF   F+FV  ++S VK+D
Sbjct:  578 YFHLCAEDYHWQWRSFLTSGFTAVYFLVYAIHYFFSKLQ-ITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 663          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S2_PONAB (Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.525e-18
Identity = 39/87 (44.83%), Postives = 57/87 (65.52%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y HLC ED+ W W++F  SG  A+Y  +Y+++Y    LQ ++G  S +LY GY++IM +   L TGTIGF   F+FV  ++S VK+D
Sbjct:  578 YFHLCAEDYHWQWRSFLTSGFTAVYFLIYAVHYFFSKLQ-ITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 663          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S2_HUMAN (Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.525e-18
Identity = 39/87 (44.83%), Postives = 57/87 (65.52%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y HLC ED+ W W++F  SG  A+Y  +Y+++Y    LQ ++G  S +LY GY++IM +   L TGTIGF   F+FV  ++S VK+D
Sbjct:  578 YFHLCAEDYHWQWRSFLTSGFTAVYFLIYAVHYFFSKLQ-ITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD 663          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S4_RAT (Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.534e-17
Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y  LC ED+RWWW+ F  SG  A YV +Y+I Y V  L  +   + +LLY GY+ +M ++  L TGTIGF  ++ FV  ++++VKID
Sbjct:  558 YFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEF-IPSLLYFGYTTLMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 643          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S4_PONAB (Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.534e-17
Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y  LC ED+RWWW+ F  SG  A YV +Y+I Y V  L  +   + +LLY GY+ +M ++  L TGTIGF  ++ FV  ++++VKID
Sbjct:  557 YFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEF-IPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 642          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S4_MOUSE (Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.534e-17
Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y  LC ED+RWWW+ F  SG  A YV +Y+I Y V  L  +   + +LLY GY+ +M ++  L TGTIGF  ++ FV  ++++VKID
Sbjct:  558 YFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEF-IPSLLYFGYTTLMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 643          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S4_HUMAN (Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 6.534e-17
Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y  LC ED+RWWW+ F  SG  A YV +Y+I Y V  L  +   + +LLY GY+ +M ++  L TGTIGF  ++ FV  ++++VKID
Sbjct:  557 YFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEF-IPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 642          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: TM9S4_BOVIN (Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 6.534e-17
Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y  LC ED+RWWW+ F  SG  A YV +Y+I Y V  L  +   + +LLY GY+ +M ++  L TGTIGF  ++ FV  ++++VKID
Sbjct:  557 YFQLCAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEF-IPSLLYFGYTALMVLSFWLLTGTIGFYAAYMFVRKIYAAVKID 642          
BLAST of DC900300 vs. ExPASy Swiss-Prot
Match: YON8_SCHPO (Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe GN=SPBC1105.08 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.901e-16
Identity = 35/87 (40.23%), Postives = 58/87 (66.67%), Query Frame = 1
Query:   73 YMHLCVEDWRWWWKAFFASGSVALYVFLYSINYLVFDLQSLSGPVSALLYLGYSLIMAVAIMLATGTIGFLTSFYFVHYLFSSVKID 333
            Y  LC E++ WWW++F   G   +YVF++S+ Y  F + S S   +A+LY GYSL+++V +    G++GF  +F FV+ +++S+KID
Sbjct:  544 YFQLCSENYNWWWRSFITPGFCGIYVFIFSVFYWFFKISS-SSLATAVLYFGYSLLISVLVFFLCGSVGFFGAFLFVNKIYASIKID 629          
The following BLAST results are available for this feature:
BLAST of DC900300 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
TM9S2_MOUSE3.465e-1845.98Transmembrane 9 superfamily member 2 OS=Mus muscul... [more]
TM9S2_RAT4.525e-1845.98Transmembrane 9 superfamily member 2 OS=Rattus nor... [more]
TM9S2_PONAB4.525e-1844.83Transmembrane 9 superfamily member 2 OS=Pongo abel... [more]
TM9S2_HUMAN4.525e-1844.83Transmembrane 9 superfamily member 2 OS=Homo sapie... [more]
TM9S4_RAT6.534e-1744.83Transmembrane 9 superfamily member 4 OS=Rattus nor... [more]
TM9S4_PONAB6.534e-1744.83Transmembrane 9 superfamily member 4 OS=Pongo abel... [more]
TM9S4_MOUSE6.534e-1744.83Transmembrane 9 superfamily member 4 OS=Mus muscul... [more]
TM9S4_HUMAN6.534e-1744.83Transmembrane 9 superfamily member 4 OS=Homo sapie... [more]
TM9S4_BOVIN6.534e-1744.83Transmembrane 9 superfamily member 4 OS=Bos taurus... [more]
YON8_SCHPO1.901e-1640.23Transmembrane 9 superfamily protein C1105.08 OS=Sc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900300 VSS Citrus sinensis cDNA clone VS28647 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900300 ID=DC900300|Name=DC900300|organism=Citrus sinensis|type=EST|length=634bp
GTCTTTGGTTTTCTGCTGATAGTTCTTTTGTTGCTGGTTGTTGTTTGCGC
TGAAGTGTCTGTGGTCCTAACATACATGCATCTTTGTGTGGAGGATTGGC
GTTGGTGGTGGAAGGCTTTCTTTGCTTCAGGATCAGTTGCACTGTATGTG
TTCCTGTACTCTATCAACTATTTGGTATTTGACCTGCAGAGTTTGAGTGG
ACCCGTCTCTGCTCTACTATATCTTGGTTATTCATTAATCATGGCAGTCG
CAATCATGTTGGCAACCGGCACCATTGGCTTCCTTACGTCTTTTTACTTC
GTCCATTACCTTTTCTCGTCTGTAAAGATTGACTGAAAAATTGTGTTTGT
GAATCAATCTTCATCGACCAGGTAGAGAAGACTCCAGTACGTAGGAAGAG
GGAGTTTTCTTGGTTCAGCCTTCCTTTTGATAGATTTAGAGATTATGATA
TGCTGTCTCATTCCCCTATATTGTTGTTCTTGTTTTTCCTATTTTACTAC
TTTTGAGCATCATTTTGGATTACCTCTCTCAGTTTACATTGACTGTTCTA
CAAAATTGTAATTTGTTGGTTTTGCTCTCCTTGTACTTTCGTTAGCTTTA
TCATTGAAGAGAATTTAAATAGTCTTTTTCTTTA
back to top