DC900296

Overview
NameDC900296
Unique NameDC900296
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length501
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1518 contig Csv1_Contig1518:764..1264. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.130e-24
Identity = 49/109 (44.95%), Postives = 73/109 (66.97%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            ++P+AD +FMKW+ H++ DE  LK LKNCY+ALPD GK++     +   P +S A++ +  +D I+L   P G+ERT++E+ +LA  AGF+G    C   N Y+MEFLK
Sbjct:  255 SIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK 363          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_PRUDU (Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.249e-23
Identity = 51/109 (46.79%), Postives = 71/109 (65.14%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ DE  LK LKNCY ALPD GK++     +   P +S A++ +  +D I+L   P G+ERT+QE+  LA  AGF+G +  C   N YV+EFLK
Sbjct:  255 SVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK 363          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_CLABR (Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.131e-23
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ DE  LK LKNCY ALP+ GK++     +   P  S A++ +  +D I+L   P G+ERT++E+  LAI AGFKG    C   N YVMEFLK
Sbjct:  260 SVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPEHGKVIVAECILPLSPDPSLATKGVIHIDAIMLAHNPGGKERTEKEFEALAIGAGFKGFKVACCAFNTYVMEFLK 368          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.783e-23
Identity = 49/109 (44.95%), Postives = 70/109 (64.22%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ DE  LK LKNCY ALPD GK++     +   P  S A++ +  +D ++L   P G+ERT+QE+  LA  +GF+G+   C   N YV+EFLK
Sbjct:  255 SVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDVVMLAHNPGGKERTEQEFEALAKGSGFQGIRVACNAFNTYVIEFLK 363          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: OMT2_CHRAE (Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 6.199e-23
Identity = 49/109 (44.95%), Postives = 71/109 (65.14%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ DE  LKLLKNCY ALP+ GK++     + EVP +S A++ +  +D I +   P G+ERT++E+  LA  AGF+G    C   N Y++EF K
Sbjct:  231 SVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK 339          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: OMT1_CHRAE (Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 6.199e-23
Identity = 49/109 (44.95%), Postives = 71/109 (65.14%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+ D IFMKW+ H++ DE  LKLLKNCY ALP+ GK++     + EVP +S A++ +  +D I +   P G+ERT++E+  LA  AGF+G    C   N Y++EF K
Sbjct:  231 SVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK 339          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_ZINEL (Caffeic acid 3-O-methyltransferase OS=Zinnia elegans PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 2.356e-22
Identity = 48/110 (43.64%), Postives = 72/110 (65.45%), Query Frame = 2
Query:    2 ENVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            E+VP+ D IFMKW+LH++ D   L++LKNCYK+LP+ GK++     + E P  + A++ +  +D I+L   P G+ERT++E+  LA  AGFKG +      N +VMEF K
Sbjct:  245 ESVPKGDAIFMKWILHDWSDAHCLQVLKNCYKSLPENGKVIVAECILPEAPDTTPATQNVIHIDVIMLAHNPGGKERTEKEFEALAKGAGFKGFNKAACALNTWVMEFCK 354          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT3_POPKI (Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 4.018e-22
Identity = 48/109 (44.04%), Postives = 70/109 (64.22%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+AD +FMKW+ H++ DE  L+LLKNCY ALP+ GK++ +   +   P  S A++ +  +D I+L   P G+ERT +E+  LA  AGFKG    C   N +V+EF K
Sbjct:  254 SVPKADAVFMKWICHDWSDEHCLRLLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDAIMLAHNPGGKERTDKEFEGLARGAGFKGFEVMCCAFNTHVIEFRK 362          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT1_CAPAN (Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 1.169e-21
Identity = 50/109 (45.87%), Postives = 68/109 (62.39%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+AD IFMKW+ H++ DE  LK LKNCY+ALP  GK+L     + E P  SAA++    +D ++L   P G+ERT++E+  LA  AGF G    C     +VMEF K
Sbjct:  251 SVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPANGKVLVAECILPETPDTSAATKNAVHVDIVMLAHNPGGKERTEKEFEALAKGAGFTGFRRACCAYQTWVMEFHK 359          
BLAST of DC900296 vs. ExPASy Swiss-Prot
Match: COMT2_POPTM (Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.527e-21
Identity = 47/109 (43.12%), Postives = 68/109 (62.39%), Query Frame = 2
Query:    5 NVPEADTIFMKWMLHNFDDEQTLKLLKNCYKALPDGGKLLNINSTISEVPQNSAASREISILDTILLIQIPHGRERTKQEYNELAIKAGFKGVSYECGVCNLYVMEFLK 331
            +VP+AD +FMKW+ H++ DE  L  LKNCY ALP+ GK++ +   +   P  S A++ +  +D I+L   P G+ERT +E+  LA  AGFKG    C   N +V+EF K
Sbjct:  254 SVPKADAVFMKWICHDWSDEHCLTFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDVIMLAHNPGGKERTDREFESLARGAGFKGFEVMCCAFNTHVIEFRK 362          
The following BLAST results are available for this feature:
BLAST of DC900296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
COMT1_MEDSA1.130e-2444.95Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
COMT1_PRUDU1.249e-2346.79Caffeic acid 3-O-methyltransferase OS=Prunus dulci... [more]
COMT1_CLABR2.131e-2347.71Caffeic acid 3-O-methyltransferase OS=Clarkia brew... [more]
COMT1_ROSCH2.783e-2344.95Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
OMT2_CHRAE6.199e-2344.95Quercetin 3-O-methyltransferase 2 OS=Chrysospleniu... [more]
OMT1_CHRAE6.199e-2344.95Quercetin 3-O-methyltransferase 1 OS=Chrysospleniu... [more]
COMT1_ZINEL2.356e-2243.64Caffeic acid 3-O-methyltransferase OS=Zinnia elega... [more]
COMT3_POPKI4.018e-2244.04Caffeic acid 3-O-methyltransferase 3 OS=Populus ki... [more]
COMT1_CAPAN1.169e-2145.87Caffeic acid 3-O-methyltransferase OS=Capsicum ann... [more]
COMT2_POPTM1.527e-2143.12Caffeic acid 3-O-methyltransferase 2 OS=Populus tr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900296 VSS Citrus sinensis cDNA clone VS28643 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900296 ID=DC900296|Name=DC900296|organism=Citrus sinensis|type=EST|length=501bp
CGAAAATGTTCCTGAGGCGGATACCATTTTCATGAAGTGGATGCTTCACA
ATTTTGATGATGAGCAAACTTTGAAATTGTTGAAGAATTGTTACAAAGCT
CTTCCAGATGGTGGGAAGCTGCTCAATATTAATTCAACAATTTCAGAAGT
GCCTCAAAATAGTGCGGCTTCAAGGGAAATCTCTATTTTGGATACAATTT
TGTTGATCCAAATTCCTCATGGAAGAGAGCGCACCAAACAAGAATACAAT
GAATTGGCAATTAAAGCTGGATTTAAAGGTGTCAGCTACGAATGTGGTGT
ATGTAATTTATATGTTATGGAGTTCTTGAAATAGATTGCTTTTTTCTCTA
TTCGGAAAGATCTCCTTAGCTTTCTTGGGTTGTTTTCAATTTCCGGTTTG
TCTTGTTATCTCTTTCCTTTGGATTGAGGGCTTCTCTTATGTAATCTCTT
TCGTTTTATCAATAATAAATCTCTTATAGGGAGATTGATTCCCGTATAAG
G
back to top