DC900289

Overview
NameDC900289
Unique NameDC900289
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length706
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900289_ssr1 microsatellite DC900289_ssr1:1..22. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4351 contig Csv1_Contig4351:374..1079. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4_ORYSJ (26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 1.098e-82
Identity = 156/172 (90.70%), Postives = 159/172 (92.44%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVAD+LSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTS+MTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH DF            EGVPEGLYM
Sbjct:  277 ELFRVADELSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHADFKKAKEKVMFKKKEGVPEGLYM 448          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4A_ARATH (26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 3.196e-82
Identity = 155/172 (90.12%), Postives = 159/172 (92.44%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTS+MTL++DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH DF            EGVPEGLYM
Sbjct:  272 ELFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHPDFKKAKEKVMFKKKEGVPEGLYM 443          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4B_ARATH (26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 7.119e-82
Identity = 155/172 (90.12%), Postives = 159/172 (92.44%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVADDLSPSIVFIDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTS+MTLA+DVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTH DF            EGVPEGLYM
Sbjct:  272 ELFRVADDLSPSIVFIDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHVDFKKAKEKVMFKKKEGVPEGLYM 443          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4_DICDI (26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 7.890e-73
Identity = 134/172 (77.91%), Postives = 153/172 (88.95%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVAD+ +PSIVFIDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGFD+R DVKVI+ATNRIE+LDPAL+RPGRIDRKIEFPLPDIKT+R+IF+IHT++M L++DVNLEEFVM+KD+ SGADIKAICTE+GLLALRERRM+VTHTDF             G PEGLYM
Sbjct:  268 ELFRVADECAPSIVFIDEIDAVGTKRYDSQSGGEREIQRTMLELLNQLDGFDARTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEIHTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVLYRKTAGAPEGLYM 439          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4_CHICK (26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.998e-72
Identity = 134/172 (77.91%), Postives = 151/172 (87.79%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVA++  PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATNRIE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHTSRMTLADDV L+E +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DF            EG PEGLY+
Sbjct:  269 ELFRVAEEHGPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENFLYKKTEGTPEGLYL 440          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4_DROME (26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Pros26.4 PE=1 SV=2)

HSP 1 Score: 271.166 bits (692), Expect = 3.916e-72
Identity = 135/172 (78.49%), Postives = 151/172 (87.79%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVA++ +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATNRIE+LDPAL+RPGRIDRKIEFPLPD KT+RRIF IHTSRMTLA+DVNL E +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DF            EG PEGLY+
Sbjct:  268 ELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL 439          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4_RAT (26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 5.114e-72
Identity = 133/172 (77.33%), Postives = 152/172 (88.37%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVA++ +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATNRIE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHTSRMTLADDV L++ +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DF            EG PEGLY+
Sbjct:  269 ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4_MOUSE (26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 5.114e-72
Identity = 133/172 (77.33%), Postives = 152/172 (88.37%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVA++ +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATNRIE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHTSRMTLADDV L++ +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DF            EG PEGLY+
Sbjct:  269 ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4_HUMAN (26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 5.114e-72
Identity = 133/172 (77.33%), Postives = 152/172 (88.37%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVA++ +PSIVFIDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGFDSRGDVKVI+ATNRIE+LDPAL+RPGRIDRKIEFPLPD KT++RIFQIHTSRMTLADDV L++ +M KD+ SGADIKAICTEAGL+ALRERRMKVT+ DF            EG PEGLY+
Sbjct:  269 ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440          
BLAST of DC900289 vs. ExPASy Swiss-Prot
Match: PRS4_CAEEL (Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 7.384e-71
Identity = 134/172 (77.91%), Postives = 149/172 (86.63%), Query Frame = 2
Query:   23 DLFRVADDLSPSIVFIDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDFXXXXXXXXXXXXEGVPEGLYM 538
            +LFRVA++ +PSIVFIDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGFDSRGDVKV++ATNRIESLDPAL+RPGRIDRKIEFPLPD KT+RRIFQIHTSRMTL  +VNLEEF+  KDE SGADIKA+CTEAGLLALRERRM+VT  DF            EG PE LY+
Sbjct:  272 ELFRVAEENAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVLMATNRIESLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTLGKEVNLEEFITAKDELSGADIKAMCTEAGLLALRERRMRVTMEDFQKSKENVLYRKKEGAPEELYL 443          
The following BLAST results are available for this feature:
BLAST of DC900289 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 353
Match NameE-valueIdentityDescription
PRS4_ORYSJ1.098e-8290.7026S protease regulatory subunit 4 homolog OS=Oryza... [more]
PRS4A_ARATH3.196e-8290.1226S proteasome regulatory subunit 4 homolog A OS=A... [more]
PRS4B_ARATH7.119e-8290.1226S proteasome regulatory subunit 4 homolog B OS=A... [more]
PRS4_DICDI7.890e-7377.9126S protease regulatory subunit 4 homolog OS=Dicty... [more]
PRS4_CHICK2.998e-7277.9126S protease regulatory subunit 4 OS=Gallus gallus... [more]
PRS4_DROME3.916e-7278.4926S protease regulatory subunit 4 OS=Drosophila me... [more]
PRS4_RAT5.114e-7277.3326S protease regulatory subunit 4 OS=Rattus norveg... [more]
PRS4_MOUSE5.114e-7277.3326S protease regulatory subunit 4 OS=Mus musculus ... [more]
PRS4_HUMAN5.114e-7277.3326S protease regulatory subunit 4 OS=Homo sapiens ... [more]
PRS4_CAEEL7.384e-7177.91Probable 26S protease regulatory subunit 4 OS=Caen... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900289 VSS Citrus sinensis cDNA clone VS28635 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900289 ID=DC900289|Name=DC900289|organism=Citrus sinensis|type=EST|length=706bp
AGAGAGAGAGAGAGAGAGAGAGGACCTTTTCAGAGTTGCTGATGATCTGT
CACCTTCTATCGTCTTCATTGATGAAATTGATGCAGTTGGTACGAAGAGG
TATGATGCCCACTCAGGTGGCGAACGTGAAATTCAGAGAACCATGTTGGA
GCTGCTGAACCAGTTGGATGGGTTTGATTCTAGAGGAGATGTCAAAGTAA
TTCTTGCAACGAACCGAATTGAAAGCCTGGATCCAGCTTTACTTCGGCCA
GGTCGAATAGATAGAAAGATTGAATTTCCTCTTCCTGATATCAAGACTAG
GAGACGTATCTTCCAGATTCACACATCAAGGATGACCTTGGCTGATGATG
TCAACTTGGAAGAGTTTGTTATGACCAAAGATGAGTTCTCTGGAGCTGAT
ATAAAGGCTATATGTACTGAAGCTGGTTTGCTTGCTTTGAGAGAGCGCCG
CATGAAGGTGACGCATACAGATTTTAAGAAAGCAAAGGAAAAGGTGATGT
TCAAGAAGAAAGAAGGGGTGCCAGAAGGGCTTTATATGTGAAAGACTTCA
TTGTTCTACATTTTACTGTTTAGTTCATTTTGCTGTATTTCCAAATTCAA
CTGTTAGCACTTTCGAAGCGGCATCTTTGGGACTTTAAACATTGTTGTTT
ACTGTTGTTTTGTAAGGTCTACATGCAAGTTAGCAACCGCTTTGGTTTCT
TTCCGT
back to top