DC900288

Overview
NameDC900288
Unique NameDC900288
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length794
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5651 contig Csv1_Contig5651:1..795. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: HNRPR_HUMAN (Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.083e-19
Identity = 47/139 (33.81%), Postives = 83/139 (59.71%), Query Frame = 1
Query:   13 RNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTE 429
            +NRGF F+ Y ++  A  +R+++++   K+ GN  TV WADP   PD    A +VK L+V+N+    + E +++ F   G++ +V         +D+ F+H+ +R +A+KA+ +    EI+G+ +E+VLAKP   K+ E
Sbjct:  287 KNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMA-KVKVLFVRNLATTVTEEILEKSFSEFGKLERV------KKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKE 418          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: HNRPQ_HUMAN (Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 6.083e-19
Identity = 54/180 (30.00%), Postives = 94/180 (52.22%), Query Frame = 1
Query:   13 RNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTE--------------GTFPYSPGLVPTHLPHAGYGGFAGTPY 510
            +NRGF F+ Y ++  A  +R+++++   K+ GN  TV WADP   PD    A +VK L+V+N+ +  + E +++ F + G++ +V         +D+ FIH+ ER  A+KA+++    +++G+ +E+V AKP   K+ E                + Y P  +P      G GG  G  Y
Sbjct:  284 KNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMA-KVKVLFVRNLANTVTEEILEKAFSQFGKLERV------KKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGY 456          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: HNRPQ_RAT (Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.944e-19
Identity = 54/180 (30.00%), Postives = 94/180 (52.22%), Query Frame = 1
Query:   13 RNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTE--------------GTFPYSPGLVPTHLPHAGYGGFAGTPY 510
            +NRGF F+ Y ++  A  +R+++++   K+ GN  TV WADP   PD    A +VK L+V+N+ +  + E +++ F + G++ +V         +D+ FIH+ ER  A+KA+++    +++G+ +E+V AKP   K+ E                + Y P  +P      G GG  G  Y
Sbjct:  194 KNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMA-KVKVLFVRNLANTVTEEILEKSFSQFGKLERV------KKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGY 366          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: HNRPQ_MOUSE (Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 7.944e-19
Identity = 54/180 (30.00%), Postives = 94/180 (52.22%), Query Frame = 1
Query:   13 RNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTE--------------GTFPYSPGLVPTHLPHAGYGGFAGTPY 510
            +NRGF F+ Y ++  A  +R+++++   K+ GN  TV WADP   PD    A +VK L+V+N+ +  + E +++ F + G++ +V         +D+ FIH+ ER  A+KA+++    +++G+ +E+V AKP   K+ E                + Y P  +P      G GG  G  Y
Sbjct:  284 KNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMA-KVKVLFVRNLANTVTEEILEKSFSQFGKLERV------KKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGY 456          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: RBM46_MOUSE (Probable RNA-binding protein 46 OS=Mus musculus GN=Rbm46 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.402e-15
Identity = 51/141 (36.17%), Postives = 77/141 (54.61%), Query Frame = 1
Query:   10 SRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQRH--GEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKT 426
            ++NRGF+FV Y ++  A  +R+K++   F+L G+T  V WADP+   D      +VK LYV+N+  +T+ E IK  F +   G V +V         RD+ F+H+  R  A+ A+       IDG  +EV LAKP   + T
Sbjct:  181 TKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVD-EETMQRVKVLYVRNLMISTTEETIKAEFSKFKPGAVERV------KKLRDYAFVHFFHREDAVAAMSVMNGKCIDGASIEVTLAKPVNKENT 314          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: RBM46_MACFA (Probable RNA-binding protein 46 OS=Macaca fascicularis GN=RBM46 PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.402e-15
Identity = 51/141 (36.17%), Postives = 77/141 (54.61%), Query Frame = 1
Query:   10 SRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQRH--GEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKT 426
            ++NRGF+FV Y ++  A  +R+K++   F+L G+T  V WADP+   D      +VK LYV+N+  +T+ E IK  F +   G V +V         RD+ F+H+  R  A+ A+       IDG  +EV LAKP   + T
Sbjct:  181 TKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVD-EETMQRVKVLYVRNLMISTTEETIKAEFNKFKPGAVERV------KKLRDYAFVHFFNREDAVAAMSVMNGKCIDGASIEVTLAKPVNKENT 314          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: RBM46_HUMAN (Probable RNA-binding protein 46 OS=Homo sapiens GN=RBM46 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.402e-15
Identity = 51/141 (36.17%), Postives = 77/141 (54.61%), Query Frame = 1
Query:   10 SRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQRH--GEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKT 426
            ++NRGF+FV Y ++  A  +R+K++   F+L G+T  V WADP+   D      +VK LYV+N+  +T+ E IK  F +   G V +V         RD+ F+H+  R  A+ A+       IDG  +EV LAKP   + T
Sbjct:  181 TKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVD-EETMQRVKVLYVRNLMISTTEETIKAEFNKFKPGAVERV------KKLRDYAFVHFFNREDAVAAMSVMNGKCIDGASIEVTLAKPVNKENT 314          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: RBM46_XENTR (Probable RNA-binding protein 46 OS=Xenopus tropicalis GN=rbm46 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.392e-15
Identity = 50/135 (37.04%), Postives = 77/135 (57.04%), Query Frame = 1
Query:   10 SRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQRH--GEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKP 408
            ++NRGF+FV+Y ++  A  +R+K++   F+L G+T  V+WA P+   D      +VK LYV+N+  +T+ E IK  F R+  G V +V         RD+ F+H+  R  A+ A+       IDG  +EV LAKP
Sbjct:  181 TKNRGFAFVMYESHRAAAMARRKLIPGPFQLWGHTIKVAWASPEKEVD-EETMQKVKVLYVRNLMMSTTEETIKAEFNRYKPGVVERV------KKIRDYAFVHFFRRDYAIAAMSVMNGRLIDGARIEVTLAKP 308          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: A1CF_PONAB (APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 5.329e-15
Identity = 49/135 (36.30%), Postives = 78/135 (57.78%), Query Frame = 1
Query:   10 SRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQ--RHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKP 408
            ++NRGF+FV Y ++  A  +R+K+L    +L G+   V WA+P+   D    +S VK LYV+N+  +TS E I++ F   + G V +V         RD+ F+H++ R  A++A+K      +DG  +EV LAKP
Sbjct:  176 TKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSS-VKILYVRNLMLSTSEEMIEKEFNNIKPGAVERV------KKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKP 303          
BLAST of DC900288 vs. ExPASy Swiss-Prot
Match: A1CF_HUMAN (APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.960e-15
Identity = 49/135 (36.30%), Postives = 78/135 (57.78%), Query Frame = 1
Query:   10 SRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTVSWADPKSTPDXSAAASQVKALYVKNIPDNTSTEKIKELFQ--RHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKP 408
            ++NRGF+FV Y ++  A  +R+K+L    +L G+   V WA+P+   D    +S VK LYV+N+  +TS E I++ F   + G V +V         RD+ F+H++ R  A++A+K      +DG  +EV LAKP
Sbjct:  176 TKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSS-VKILYVRNLMLSTSEEMIEKEFNNIKPGAVERV------KKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKP 303          
The following BLAST results are available for this feature:
BLAST of DC900288 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
HNRPR_HUMAN6.083e-1933.81Heterogeneous nuclear ribonucleoprotein R OS=Homo ... [more]
HNRPQ_HUMAN6.083e-1930.00Heterogeneous nuclear ribonucleoprotein Q OS=Homo ... [more]
HNRPQ_RAT7.944e-1930.00Heterogeneous nuclear ribonucleoprotein Q OS=Rattu... [more]
HNRPQ_MOUSE7.944e-1930.00Heterogeneous nuclear ribonucleoprotein Q OS=Mus m... [more]
RBM46_MOUSE1.402e-1536.17Probable RNA-binding protein 46 OS=Mus musculus GN... [more]
RBM46_MACFA1.402e-1536.17Probable RNA-binding protein 46 OS=Macaca fascicul... [more]
RBM46_HUMAN1.402e-1536.17Probable RNA-binding protein 46 OS=Homo sapiens GN... [more]
RBM46_XENTR2.392e-1537.04Probable RNA-binding protein 46 OS=Xenopus tropica... [more]
A1CF_PONAB5.329e-1536.30APOBEC1 complementation factor OS=Pongo abelii GN=... [more]
A1CF_HUMAN6.960e-1536.30APOBEC1 complementation factor OS=Homo sapiens GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900288 VSS Citrus sinensis cDNA clone VS28634 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900288 ID=DC900288|Name=DC900288|organism=Citrus sinensis|type=EST|length=794bp
CAAAATCCTTCTCGTAATCGTGGTTTTTCCTTTGTTTTGTATTACAATAA
TGCCTGTGCTGATTATTCAAGGCAGAAAATGCTCAATGCAAACTTTAAGT
TGGATGGAAATACTCCAACCGTCTCATGGGCTGATCCTAAGAGTACACCT
GATNACTCTGCTGCTGCTTCTCAGGTGAAGGCACTTTATGTGAAAAATAT
ACCTGACAACACTTCTACTGAGAAAATAAAAGAACTCTTCCAGCGTCATG
GGGAAGTGACGAAAGTGGTCATGCCTCCTGGAAAATCTGGGAAACGTGAT
TTTGGGTTCATCCATTATGCTGAAAGGTCAAGTGCATTAAAGGCTGTCAA
GGATACTGAGAAATATGAAATTGATGGCCAAGTATTGGAGGTTGTTCTTG
CAAAGCCTCAGACGGATAAGAAAACCGAAGGAACTTTTCCCTACAGTCCT
GGGCTGGTTCCAACCCATTTACCACATGCAGGGTATGGTGGCTTTGCTGG
GACTCCTTATGGCTCCGTAGGTGCTGGATTTGGAGTTGCTGCTGGTTTCC
AGCAGCCCATGATATATGGTAGGGGTCCAATGCCATCAGGGATGCATATG
GTGCCAATGGTCTTACCAGATGGTCAAATTGGCTATGTTCTTCAGCAGCC
TGGAGTACAGATGCCGCCTNCTCGACCACGGAGAGTTGATAGGAGCAATG
GTCCTGGTGGACGTGGAGGACNAGGTGNAGTAGCGGCGGTGATGATGGCA
ACCGTGGCAGAAGAATCGACCCTATAGATGGAGAACATGTAGTT
back to top