DC900286

Overview
NameDC900286
Unique NameDC900286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1248
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABPX_ARATH (Probable polyadenylate-binding protein At2g36660 OS=Arabidopsis thaliana GN=At2g36660 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.637e-36
Identity = 80/127 (62.99%), Postives = 95/127 (74.80%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHM-AGIEGSSANVIPSGYPSLYYT-TPPGIVSQVPP 377
            N+YVKN++  VT+EEL+ HFSQCGTITS K+M DEKG +KGFGFVCFS+PEEA  AV TFHG M H KPLYVAIAQ+KEDR+  LQ+Q+   + A    SSA+V P  Y  LYYT T PG+V Q  P
Sbjct:  305 NIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEKGKSKGFGFVCFSTPEEAIDAVKTFHGQMFHGKPLYVAIAQKKEDRKMQLQVQFGNRVEARKSSSSASVNPGTYAPLYYTNTHPGMVYQSYP 431          

HSP 2 Score: 72.4034 bits (176), Expect = 6.266e-12
Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            N+Y+KN+D DV+++ L+  F++ G I S  + +DE  + +G+ FV F +PE+A +A  T +G     K LYV  AQ+K +R+  L+ Q+ +
Sbjct:  202 NLYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDENRLCRGYAFVNFDNPEDARRAAETVNGTKFGSKCLYVGRAQKKAEREQLLREQFKE 292          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP1_RAT (Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.641e-29
Identity = 75/144 (52.08%), Postives = 91/144 (63.19%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVI-------PSGY----------PSLYYTTPPGIVSQVPPRP 383
            N+YVKN+DD + DE L+  FS  GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+RQAHL  QY Q MA +      VI       PSGY           + YY  PP  ++Q+ P P
Sbjct:  295 NLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM-EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYY--PPSQIAQLRPSP 435          

HSP 2 Score: 85.5001 bits (210), Expect = 7.152e-16
Identity = 43/91 (47.25%), Postives = 58/91 (63.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ DE LK  F + G   S KVM DE G +KGFGFV F   E+A KAV+  +G  L+ K +YV  AQ+K +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          

HSP 3 Score: 73.9442 bits (180), Expect = 2.161e-12
Identity = 37/80 (46.25%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  736 MLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAIH 975
            MLA+A P++QKQ+LGERL+PL++   P L  KITGMLL++DN               KV+EAV VL+  +AK + Q+A++
Sbjct:  549 MLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVN 628          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP1_PONAB (Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.641e-29
Identity = 75/144 (52.08%), Postives = 91/144 (63.19%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVI-------PSGY----------PSLYYTTPPGIVSQVPPRP 383
            N+YVKN+DD + DE L+  FS  GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+RQAHL  QY Q MA +      VI       PSGY           + YY  PP  ++Q+ P P
Sbjct:  295 NLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM-EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYY--PPSQIAQLRPSP 435          

HSP 2 Score: 85.1149 bits (209), Expect = 9.341e-16
Identity = 43/91 (47.25%), Postives = 58/91 (63.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ DE LK  F + G   S KVM DE G +KGFGFV F   E+A KAV+  +G  L+ K +YV  AQ+K +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          

HSP 3 Score: 73.559 bits (179), Expect = 2.822e-12
Identity = 37/80 (46.25%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  736 MLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAIH 975
            MLA+A P++QKQ+LGERL+PL++   P L  KITGMLL++DN               KV+EAV VL+  +AK + Q+A++
Sbjct:  549 MLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVN 628          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP1_MOUSE (Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.641e-29
Identity = 75/144 (52.08%), Postives = 91/144 (63.19%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVI-------PSGY----------PSLYYTTPPGIVSQVPPRP 383
            N+YVKN+DD + DE L+  FS  GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+RQAHL  QY Q MA +      VI       PSGY           + YY  PP  ++Q+ P P
Sbjct:  295 NLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM-EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYY--PPSQIAQLRPSP 435          

HSP 2 Score: 85.5001 bits (210), Expect = 7.152e-16
Identity = 43/91 (47.25%), Postives = 58/91 (63.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ DE LK  F + G   S KVM DE G +KGFGFV F   E+A KAV+  +G  L+ K +YV  AQ+K +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          

HSP 3 Score: 73.9442 bits (180), Expect = 2.161e-12
Identity = 37/80 (46.25%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  736 MLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAIH 975
            MLA+A P++QKQ+LGERL+PL++   P L  KITGMLL++DN               KV+EAV VL+  +AK + Q+A++
Sbjct:  549 MLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVN 628          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP1_HUMAN (Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 5.641e-29
Identity = 75/144 (52.08%), Postives = 91/144 (63.19%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVI-------PSGY----------PSLYYTTPPGIVSQVPPRP 383
            N+YVKN+DD + DE L+  FS  GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+RQAHL  QY Q MA +      VI       PSGY           + YY  PP  ++Q+ P P
Sbjct:  295 NLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM-EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYY--PPSQIAQLRPSP 435          

HSP 2 Score: 85.1149 bits (209), Expect = 9.341e-16
Identity = 43/91 (47.25%), Postives = 58/91 (63.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ DE LK  F + G   S KVM DE G +KGFGFV F   E+A KAV+  +G  L+ K +YV  AQ+K +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          

HSP 3 Score: 73.559 bits (179), Expect = 2.822e-12
Identity = 37/80 (46.25%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  736 MLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAIH 975
            MLA+A P++QKQ+LGERL+PL++   P L  KITGMLL++DN               KV+EAV VL+  +AK + Q+A++
Sbjct:  549 MLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVN 628          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP1_BOVIN (Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.641e-29
Identity = 75/144 (52.08%), Postives = 91/144 (63.19%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVI-------PSGY----------PSLYYTTPPGIVSQVPPRP 383
            N+YVKN+DD + DE L+  FS  GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+RQAHL  QY Q MA +      VI       PSGY           + YY  PP  ++Q+ P P
Sbjct:  295 NLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM-EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYY--PPSQIAQLRPSP 435          

HSP 2 Score: 85.1149 bits (209), Expect = 9.341e-16
Identity = 43/91 (47.25%), Postives = 58/91 (63.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ DE LK  F + G   S KVM DE G +KGFGFV F   E+A KAV+  +G  L+ K +YV  AQ+K +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQ 282          

HSP 3 Score: 73.559 bits (179), Expect = 2.822e-12
Identity = 37/80 (46.25%), Postives = 53/80 (66.25%), Query Frame = 1
Query:  736 MLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAIH 975
            MLA+A P++QKQ+LGERL+PL++   P L  KITGMLL++DN               KV+EAV VL+  +AK + Q+A++
Sbjct:  549 MLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVN 628          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABPA_XENLA (Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-A PE=1 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 1.257e-28
Identity = 76/164 (46.34%), Postives = 95/164 (57.93%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIP-SGYPSLYYTT------------PPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTRP 455
            N+YVKN+DD + DE L+  F   GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+RQAHL  QY Q MA +   +  + P    PS Y+              PPG ++Q+ P P    Q           G + PT P
Sbjct:  295 NLYVKNLDDGIDDERLRKEFLPFGTITSAKVMM-EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRVPNPVINPYQPPPSSYFMAAIPPAQNRAAYYPPGQIAQLRPSPRWTAQGARPHPFQNMPGAIRPTAP 457          

HSP 2 Score: 83.9593 bits (206), Expect = 2.081e-15
Identity = 41/91 (45.05%), Postives = 58/91 (63.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  DD+ DE LK  F + G   S KVM D+ G +KGFGFV F   E+A KAV+  +G  ++ K ++V  AQ+K +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGDDMNDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDEMNGKDMNGKSMFVGRAQKKVERQTELKRKFEQ 282          

HSP 3 Score: 73.1738 bits (178), Expect = 3.686e-12
Identity = 37/80 (46.25%), Postives = 52/80 (65.00%), Query Frame = 1
Query:  736 MLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAIH 975
            MLAAA P++QKQ+LGERL+PL++   P L  KITGMLL++DN               KV+EAV VL+  +AK + Q+ ++
Sbjct:  547 MLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKVVN 626          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABPB_XENLA (Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-B PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.775e-28
Identity = 70/140 (50.00%), Postives = 90/140 (64.29%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEGSSANVIP-SGYPSLYYTT------------PPGIVSQVPPRP 383
            N+YVKN+DD + DE L+  F+  G+ITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+RQAHL  QY Q MA +   +  + P    PS Y+              PPG ++Q+ P P
Sbjct:  295 NLYVKNLDDGIDDERLRKEFTPFGSITSAKVMM-EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRVPNPVINPYQPPPSSYFMAAIPPAQNRAAYYPPGQIAQLRPSP 433          

HSP 2 Score: 83.1889 bits (204), Expect = 3.550e-15
Identity = 41/91 (45.05%), Postives = 58/91 (63.74%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ DE LK  F Q G   S KVM D+ G ++GFGFV F   E+A KAV+  +G  L+ K ++V  AQ+K +RQ  L+ ++ Q
Sbjct:  192 NVYIKNFGEDMDDERLKEWFGQYGAALSVKVMTDDHGKSRGFGFVSFERHEDAQKAVDDMNGKDLNGKAIFVGRAQKKVERQTELKRKFEQ 282          

HSP 3 Score: 72.7886 bits (177), Expect = 4.814e-12
Identity = 37/79 (46.84%), Postives = 51/79 (64.56%), Query Frame = 1
Query:  736 MLAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAI 972
            MLAAA P++QKQ+LGERL+PL++   P L  KITGMLL++DN               KV+EAV VL+  +AK + Q+ +
Sbjct:  547 MLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKVV 625          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP2_ARATH (Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.775e-28
Identity = 76/169 (44.97%), Postives = 100/169 (59.17%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ----HMAGIEGSSANVIPSGYPSL-----YYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANG------FVPPTRPAFQ 464
            N+YVKN+D  ++DE+LK  FS  GT+TS+KVMRD  G +KG GFV F++PEEA++A++   G M+  KPLYVAIAQRKEDR+  LQ Q++Q     M    G    V P G P +     Y   PP   + +PP+PG  YQ   L  G R  G      F+P  +P  Q
Sbjct:  319 NLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIAQRKEDRRVRLQAQFSQVRPVAMQPSVGPRMPVYPPGGPGIGQQMFYGQAPP---AMIPPQPGYGYQQ-QLVPGMRPGGGPVPSFFMPMVQPQQQ 483          

HSP 2 Score: 88.1965 bits (217), Expect = 1.103e-16
Identity = 41/93 (44.09%), Postives = 65/93 (69.89%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHM 281
            NVYVKN+ +  TD++LK  F + G ITSA VM+D +G +KGFGFV F + ++A++AV + +G+    K  YV  AQ+K +R+  L+++Y Q++
Sbjct:  216 NVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQKKSERETELRVRYEQNL 308          
BLAST of DC900286 vs. ExPASy Swiss-Prot
Match: PABP3_HUMAN (Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 1.064e-27
Identity = 76/163 (46.63%), Postives = 94/163 (57.67%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQHMAGIEG-SSANVIPSGYPSLYYTTPPGIVSQVPPRPGLMYQPLGLRTGWRANGFVPPTRPAFQVSPLPVNP 488
            N+YVKN+DD + DE L+  FS  GTITSAKVM  E G +KGFGFVCFSSPEEA+KAV   +G ++  KPLYVA+AQRKE+RQA+L  +Y Q MA +    +    PSGY   + T  P   +     P      L     W A G  P     FQ  P  + P
Sbjct:  295 NLYVKNLDDGIDDERLRKAFSPFGTITSAKVMM-EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAYLTNEYMQRMASVRAVPNQRAPPSGY---FMTAVPQTQNHAAYYPPSQIARLRPSPRWTAQGARP---HPFQNKPSAIRP 450          

HSP 2 Score: 84.3445 bits (207), Expect = 1.593e-15
Identity = 43/91 (47.25%), Postives = 57/91 (62.64%), Query Frame = 3
Query:    3 NVYVKNIDDDVTDEELKAHFSQCGTITSAKVMRDEKGINKGFGFVCFSSPEEASKAVNTFHGYMLHRKPLYVAIAQRKEDRQAHLQLQYAQ 275
            NVY+KN  +D+ DE LK  F + G   S KVM DE G +KGFGFV F   E+A KAV+  +G  L+ K +YV  AQ+K +RQ  L+  + Q
Sbjct:  192 NVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRTFEQ 282          

HSP 3 Score: 73.1738 bits (178), Expect = 3.686e-12
Identity = 37/79 (46.84%), Postives = 53/79 (67.09%), Query Frame = 1
Query:  739 LAAASPEQQKQILGERLYPLVEKHKPDLVAKITGMLLQMDNXXXXXXXXXXXXXAVKVEEAVQVLKLSEAKVSTQEAIH 975
            LA+A P++QKQ+LGERL+PL++   P L  KITGMLL++DN               KV+EAV VL+  +AK +TQ+A++
Sbjct:  545 LASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRSKVDEAVAVLQAHQAKEATQKAVN 623          
The following BLAST results are available for this feature:
BLAST of DC900286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
PABPX_ARATH1.637e-3662.99Probable polyadenylate-binding protein At2g36660 O... [more]
PABP1_RAT5.641e-2952.08Polyadenylate-binding protein 1 OS=Rattus norvegic... [more]
PABP1_PONAB5.641e-2952.08Polyadenylate-binding protein 1 OS=Pongo abelii GN... [more]
PABP1_MOUSE5.641e-2952.08Polyadenylate-binding protein 1 OS=Mus musculus GN... [more]
PABP1_HUMAN5.641e-2952.08Polyadenylate-binding protein 1 OS=Homo sapiens GN... [more]
PABP1_BOVIN5.641e-2952.08Polyadenylate-binding protein 1 OS=Bos taurus GN=P... [more]
PABPA_XENLA1.257e-2846.34Polyadenylate-binding protein 1-A OS=Xenopus laevi... [more]
PABPB_XENLA4.775e-2850.00Polyadenylate-binding protein 1-B OS=Xenopus laevi... [more]
PABP2_ARATH4.775e-2844.97Polyadenylate-binding protein 2 OS=Arabidopsis tha... [more]
PABP3_HUMAN1.064e-2746.63Polyadenylate-binding protein 3 OS=Homo sapiens GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900286 VSS Citrus sinensis cDNA clone VS28632 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900286 ID=DC900286|Name=DC900286|organism=Citrus sinensis|type=EST|length=1248bp
CAAATGTTTATGTGAAGAACATTGATGATGATGTTACCGATGAAGAGCTA
AAAGCGCACTTCAGTCAGTGTGGCACAATTACTTCAGCAAAAGTGATGCG
AGATGAGAAAGGAATAAATAAGGGCTTTGGATTTGTGTGCTTCTCAAGCC
CAGAGGAGGCCAGTAAAGCTGTGAACACTTTCCATGGTTACATGTTACAC
CGCAAGCCATTGTACGTGGCTATTGCTCAAAGGAAGGAGGACAGACAAGC
ACATCTGCAACTTCAGTATGCACAGCATATGGCTGGAATAGAAGGAAGTT
CAGCTAATGTTATTCCCAGTGGATATCCTTCTCTTTACTACACAACTCCT
CCAGGTATTGTTTCACAAGTACCACCACGTCCTGGGCTGATGTACCAACC
TTTGGGTTTGAGGACGGGTTGGAGGGCCAATGGCTTTGTGCCACCAACCA
GACCAGCATTTCAAGTATCACCACTGCCAGTTAACCCAAAACACAATAGG
CAAAACAGAGGTAGGATGAATGGGAATATGCTTCCACAAGTAGGTGCTCA
CTATATGCAACAGTCCTCTCAATCTGCAGCTTCTTCAAAAGATTCAAGCA
ATCAACAGAAGGGTGGGCAAAGCAAGTATGTACCAAATGGTCGTACACGT
GAGTTAAACAAAGGATCTGGAGTCTCATTAGGTACTTTTAAATTCTGGTG
GAGTAATGGCGCGGAAACCAGATATGCTCAATGGTATGCTTGCCGCAGCT
TCCCCTGAGCAACAAAAACAGATACTTGGAGAGCGTCTGTACCCTCTTGT
CGAGAAACACAAGCCTGATCTTGTTGCCAAAATTACGGGAATGCTACTAC
AGATGGACAACTCGGAACTGCTGCTGTTATTGGAATCACCAGAGTCATTG
GCTGTAAAAGTGGAGGAAGCTGTGCAAGTGCTAAAGCTCTCAGAAGCCAA
AGTTTCAACTCAGGAAGCCATTCATCCCAATTACCTATCTGCTGAGGTTG
CAGTCAATTGAGAAGGCAAGCCCAAATTGTGCTGAAAAATATAGAGGTGC
TCACCAAATCGAAGAGGCCAAACTTGTTTTTGATACCATTAGCGAACATT
CATTTAGTTCATTTGTTTCTTTTTTTTTGTTTTTTTTTAACTGTTATTAG
AATCATTTTCTTTTTGGGTATAGGACATTGTTTCGTGTCTTTATTGAAGA
AGAAAGATTGATACTGTTGATCCTATGTTTATTTAACTGACAACTATT
back to top