DC900280

Overview
NameDC900280
Unique NameDC900280
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length791
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GLT2_ARATH (Germin-like protein subfamily T member 2 OS=Arabidopsis thaliana GN=At1g18980 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.399e-46
Identity = 97/196 (49.49%), Postives = 125/196 (63.78%), Query Frame = 2
Query:   53 SHASDPDPLQDICVADLDAPISINGFPCKP---ASEVXXXXXXXXXXXXXXXXXVFKRAVTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFVTTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRS 631
            S +SD DPLQD CV DL A  SINGFPCK    AS+                      AV+  +V  FP +NT G+S+  ++   GG+NPPH+HPRATEAG+V++G V VGF+TTNNT FSKVL  G +F++PR  VHFQ NVGK KA  +  FNSQ PG +    TLF +NP++PN+VLTK+F   D  +N ++S
Sbjct:   25 SLSSDSDPLQDFCVGDLKASPSINGFPCKSSVSASDFFFSGLGGPLNTSTPNGV----AVSPANVLTFPGLNTLGLSMNNVEFAPGGVNPPHSHPRATEAGVVIEGSVFVGFLTTNNTLFSKVLNAGEMFVVPRGLVHFQWNVGKVKARLITSFNSQLPGSAVLPSTLFGSNPTIPNAVLTKTFRTDDVTVNKLKS 216          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GL33_ORYSJ (Germin-like protein 3-3 OS=Oryza sativa subsp. japonica GN=Os03g0693700 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 9.257e-44
Identity = 94/199 (47.24%), Postives = 119/199 (59.80%), Query Frame = 2
Query:   59 ASDPDPLQDICVADLDAPISINGFPCKPASEVXXXXXXXXXXXXXXXXXVFKRA--VTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFV---TTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRSART 640
            A+DPDPLQD CVADLD+ +++NG+PCKP                            VT  DV G+P VNT GVS+ RID   GG NPPH HPRATE GIVL+G +LVG +    T N ++S+V+  G  F+IPR  +HFQ NVGK +AT V  FNSQNPG+     TLF +NP +P  VL K+  V   V+  ++S  T
Sbjct:   26 ANDPDPLQDFCVADLDSEVTLNGYPCKPTPAAGDEFLFSSRLATGGDVNANPNGSNVTQLDVAGWPGVNTLGVSMNRIDFAPGGTNPPHVHPRATEVGIVLRGELLVGIIGSLDTGNRYYSRVVRGGETFVIPRGLMHFQFNVGKTEATMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLVKALRVDAGVVELLKSKFT 224          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GLT1_ARATH (Germin-like protein subfamily T member 1 OS=Arabidopsis thaliana GN=GLP1 PE=2 SV=2)

HSP 1 Score: 174.866 bits (442), Expect = 4.594e-43
Identity = 92/195 (47.18%), Postives = 115/195 (58.97%), Query Frame = 2
Query:   53 SHASDPDPLQDICVADLDAPISINGFPCKPASEVXXXXXXXXXXXXXXXXXVFKRAVTFG--DVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFVTTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRS 631
            S +SD DPLQD CV DL A  SINGFPCK A                         VT    +V  FP +NT G+S+  ++L  GG+NPPH HPRATE G V++G V VGF++TNNT FSKVL  G  F+IPR  VHFQ NVG+ KA  +  FNSQ PG      TLF + P +PN+VLT++F   D  +  ++S
Sbjct:   25 SLSSDSDPLQDFCVGDLKASASINGFPCKSAVSASDFFYSGLGGPLDTSNP---NGVTVAPANVLTFPGLNTLGISMNNVELAPGGVNPPHLHPRATEVGTVIEGSVFVGFLSTNNTLFSKVLNAGEAFVIPRGLVHFQWNVGQVKARMITAFNSQLPGAVVLPSTLFGSKPEIPNAVLTRAFRTDDTTVQNLKS 216          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: OXO2_HORVU (Oxalate oxidase 2 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.889e-42
Identity = 95/196 (48.47%), Postives = 117/196 (59.69%), Query Frame = 2
Query:   59 ASDPDPLQDICVADLDAP-ISINGFPCKPASEVXXXXXXXXXXXXXXXXXVFK-RAVTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFV---TTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRS 631
            ASDPDPLQD CVADLD   +S+NG PCKP SE                       AVT  DV  +P  NT GVS+ R+D   GG NPPH HPRATE GIV+KG +LVG +    + N  +S+V+  G  FLIPR  +HFQ NVGK +A+ V  FNSQNPG+     TLF +NP +P  VLTK+  V   V+  ++S
Sbjct:   23 ASDPDPLQDFCVADLDGKAVSVNGHPCKPMSEAGDDFLFSSKLAKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHVHPRATEIGIVMKGELLVGILGSLDSGNKLYSRVVRAGETFLIPRGLMHFQFNVGKTEASMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLTKALRVEAGVVELLKS 218          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GL36_ORYSJ (Germin-like protein 3-6 OS=Oryza sativa subsp. japonica GN=Os03g0694000 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.079e-42
Identity = 93/199 (46.73%), Postives = 117/199 (58.79%), Query Frame = 2
Query:   59 ASDPDPLQDICVADLDAPISINGFPCKPASEVXXXXXXXXXXXXXXXXXVFKRA--VTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFV---TTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRSART 640
            A+D DPLQD CVADLD+ +++NG  CKPAS                          VT  DV  +P VNT GVS+ R+D   GG NPPH HPRATE GIVL+G +LVG +    T N ++SKV+  G  F+IPR  +HFQ NVGK +AT V  FNSQNPG+     TLF +NP +P  VL K+  V   V+  ++S  T
Sbjct:   28 ATDADPLQDFCVADLDSKVTVNGHACKPASAAGDEFLFSSKIATGGDVNANPNGSNVTELDVAEWPGVNTLGVSMNRVDFAPGGTNPPHVHPRATEVGIVLRGELLVGIIGTLDTGNRYYSKVVRAGETFVIPRGLMHFQFNVGKTEATMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLVKALRVDAGVVELLKSKFT 226          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GL34_ORYSJ (Putative germin-like protein 3-4 OS=Oryza sativa subsp. japonica GN=Os03g0693800 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.079e-42
Identity = 93/199 (46.73%), Postives = 117/199 (58.79%), Query Frame = 2
Query:   59 ASDPDPLQDICVADLDAPISINGFPCKPASEVXXXXXXXXXXXXXXXXXVFKRA--VTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFVTT---NNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRSART 640
            A+D DPLQD CVADLD+ +++NG  CKPAS                          VT  DV  +P VNT GVS+ R+D   GG NPPH HPRATE GIVL+G +LVG + T    N ++SKV+  G  F+IPR  +HFQ NVGK +AT V  FNSQNPG+     TLF +NP +P  VL K+  V   V+  ++S  T
Sbjct:   28 ATDADPLQDFCVADLDSKVTVNGHACKPASAAGDEFLFSSKIATGGDVNANPNGSNVTELDVAEWPGVNTLGVSMNRVDFAPGGTNPPHVHPRATEVGIVLRGELLVGIIGTLDMGNRYYSKVVRAGETFVIPRGLMHFQFNVGKTEATMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLVKALRVDTGVVELLKSKFT 226          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GL12_ORYSJ (Germin-like protein 1-2 OS=Oryza sativa subsp. japonica GN=Os01g0705100 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.079e-42
Identity = 90/191 (47.12%), Postives = 118/191 (61.78%), Query Frame = 2
Query:   62 SDPDPLQDICVADLDAPISINGFPCKP-ASEVXXXXXXXXXXXXXXXXXVFKRAVTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFVTTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRS 631
            +D  PLQDICVADL A  +++GFPCKP AS V                  F    T   V  FP +NT G+S+ R DL  GG+NPPH+HPRA+E  +VL G V+VGF T  N  FSKV+    +F++PR   HFQLNVG G A+FV +F+SQ+PG+      LF T P++P  VL K+FL+ +D + AI+S
Sbjct:   29 ADSPPLQDICVADLRAATAVDGFPCKPTASVVSDDFFCDAIVQAPSTSNPFGVNSTRATVSAFPGLNTLGLSITRTDLAPGGLNPPHSHPRASELVLVLSGEVMVGFTTAANRLFSKVVREKELFVVPRGLQHFQLNVGAGNASFVAMFDSQSPGLVTPTFALFATQPAMPMEVLAKTFLMGEDEVGAIKS 219          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GL35_ORYSJ (Germin-like protein 3-5 OS=Oryza sativa subsp. japonica GN=Os03g0693900 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.930e-41
Identity = 92/199 (46.23%), Postives = 117/199 (58.79%), Query Frame = 2
Query:   59 ASDPDPLQDICVADLDAPISINGFPCKPASEVXXXXXXXXXXXXXXXXXVFKRA--VTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFV---TTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRSART 640
            A+D DPLQD CVADL++ +++NG  CKPAS                          VT  DV  +P VNT GVS+ R+D   GG NPPH HPRATE GIVL+G +LVG +    T N ++SKV+  G  F+IPR  +HFQ NVGK +AT V  FNSQNPG+     TLF +NP +P  VL K+  V   V+  ++S  T
Sbjct:   26 ATDADPLQDFCVADLNSEVTVNGHACKPASAAGDEFLFSSKIATGGDVNANPNGSNVTELDVAEWPGVNTLGVSMNRVDFAPGGTNPPHVHPRATEVGIVLRGELLVGIIGTLDTGNRYYSKVVRAGETFVIPRGLMHFQFNVGKTEATMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLVKALRVDAGVVELLKSKFT 224          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GER2_WHEAT (Oxalate oxidase GF-2.8 OS=Triticum aestivum PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.251e-40
Identity = 93/196 (47.45%), Postives = 116/196 (59.18%), Query Frame = 2
Query:   59 ASDPDPLQDICVADLDAP-ISINGFPCKPASEVXXXXXXXXXXXXXXXXXVFK-RAVTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFV---TTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRS 631
            A+DPDPLQD CVADLD   +S+NG  CKP SE                       AVT  DV  +P  NT GVS+ R+D   GG NPPH HPRATE GIV+KG +LVG +    + N  +S+V+  G  FLIPR  +HFQ NVGK +A+ V  FNSQNPG+     TLF +NP +P  VLTK+  V   V+  ++S
Sbjct:   23 ATDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLAKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGIVMKGELLVGILGSLDSGNKLYSRVVRAGETFLIPRGLMHFQFNVGKTEASMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLTKALRVEARVVELLKS 218          
BLAST of DC900280 vs. ExPASy Swiss-Prot
Match: GL11_ORYSJ (Germin-like protein 1-1 OS=Oryza sativa subsp. japonica GN=GER4 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 8.109e-40
Identity = 91/193 (47.15%), Postives = 111/193 (57.51%), Query Frame = 2
Query:   53 SHASDPDPLQDICVADLDAPISINGFPCKPASEVXXXXXXXXXXXXXXXXXVFKRAVTFGDVFGFPAVNTQGVSLFRIDLGVGGINPPHTHPRATEAGIVLKGRVLVGFVTTNNTFFSKVLTPGMVFLIPRAHVHFQLNVGKGKATFVPIFNSQNPGVSDSVGTLFDTNPSVPNSVLTKSFLVSDDVINAIRS 631
            S A DPD LQD+CVADL +P+ +NGFPCK A+                        VT  +V  FP VNT GVS+ RID   GG NPPHTHPRATE   VL+G + VGF+TT N  F+K +T G VF+ PR  VHFQ N G G A  +  FNSQ  G      TLF   P VP+ VL K+F V    ++AI++
Sbjct:   22 SLAGDPDMLQDVCVADLASPVKLNGFPCK-ANVTADDFFFAGLKNPGNTNNPAGSNVTAANVQSFPGVNTLGVSMARIDYAPGGQNPPHTHPRATEIIFVLEGVLEVGFITTANKLFTKTVTAGEVFVFPRGLVHFQQNRGHGPAAVIAAFNSQLQGTQAIAATLFAAAPPVPSDVLAKAFRVDVPQVDAIKA 213          
The following BLAST results are available for this feature:
BLAST of DC900280 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
GLT2_ARATH3.399e-4649.49Germin-like protein subfamily T member 2 OS=Arabid... [more]
GL33_ORYSJ9.257e-4447.24Germin-like protein 3-3 OS=Oryza sativa subsp. jap... [more]
GLT1_ARATH4.594e-4347.18Germin-like protein subfamily T member 1 OS=Arabid... [more]
OXO2_HORVU3.889e-4248.47Oxalate oxidase 2 OS=Hordeum vulgare PE=2 SV=1[more]
GL36_ORYSJ5.079e-4246.73Germin-like protein 3-6 OS=Oryza sativa subsp. jap... [more]
GL34_ORYSJ5.079e-4246.73Putative germin-like protein 3-4 OS=Oryza sativa s... [more]
GL12_ORYSJ5.079e-4247.12Germin-like protein 1-2 OS=Oryza sativa subsp. jap... [more]
GL35_ORYSJ1.930e-4146.23Germin-like protein 3-5 OS=Oryza sativa subsp. jap... [more]
GER2_WHEAT1.251e-4047.45Oxalate oxidase GF-2.8 OS=Triticum aestivum PE=1 S... [more]
GL11_ORYSJ8.109e-4047.15Germin-like protein 1-1 OS=Oryza sativa subsp. jap... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900280 VSS Citrus sinensis cDNA clone VS28627 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900280 ID=DC900280|Name=DC900280|organism=Citrus sinensis|type=EST|length=791bp
ATCAATGTCACTCTTCGGGCTGCTACTAGTGTTAGTGATTCTACCCTTCC
CTTCCCACGCAAGTGACCCTGATCCCTTACAAGACATCTGTGTTGCGGAT
TTGGATGCCCCCATCTCGATCAATGGTTTCCCGTGCAAGCCTGCTTCGGA
AGTGACTTCTGATGATTTCTTCACGGATTTTTCCAAGGATCCGACGACAT
TCGATGTCTTTAAGCGTGCAGTTACATTTGGTGATGTGTTTGGCTTTCCA
GCGGTCAACACTCAAGGAGTTTCACTCTTCCGAATTGACCTGGGTGTCGG
CGGAATAAATCCGCCTCACACGCATCCTCGCGCAACTGAGGCTGGTATTG
TTCTTAAAGGGAGGGTGCTTGTGGGATTTGTAACAACTAATAATACCTTT
TTCTCAAAGGTTTTGACTCCCGGGATGGTGTTCTTAATTCCTAGAGCACA
TGTCCATTTCCAATTAAACGTTGGAAAAGGAAAGGCTACTTTCGTGCCCA
TTTTCAACAGTCAAAATCCCGGCGTTTCGGATTCAGTCGGTACTCTGTTT
GATACTAATCCCTCAGTTCCCAATAGTGTGTTGACCAAATCTTTCCTAGT
AAGTGATGATGTGATCAATGCCATCAGATCGGCTCGAACGTCAAATAAGT
CTGGCCATCAATTCAACACCCGGTCTAGCTATTAGCATTCTCCATGCTTG
ATCGATATCTTTTATTGTCTCAAAATTGTTAGATTTATTTTATCTAGCAA
TTGTTAAATAAAATTACAGCTGAGGCAATATATAACTATCG
back to top