DC900278

Overview
NameDC900278
Unique NameDC900278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1108
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5649 contig Csv1_Contig5649:1..1108. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_BOVIN (Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 3.809e-50
Identity = 126/344 (36.63%), Postives = 187/344 (54.36%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDG-ELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            + F  T+N DV   + LD +     +V+ KK  E  + F+G+  K  + DF+  N+LPLV  FT + AP +F   IK  +LLF   +  D E  L  F++AA+SFKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  +  ELT +KI  F   FL GK+KP   S  +P+  D   VK++VG NF+E+  DE K+V +E YAPWCGHC+   P ++KL +  +  ++IVIAKMD T NE    K   FPT+ FFPA +     I+ + +RT+    KFL+              A   +      +AE  D++   E    K VKDEL
Sbjct:  184 IPFGITSNSDVFSKYQLDKD----GVVLFKKFDEGRNNFEGEVTKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLSNFKKAAESFKGKILFIFIDSDHTD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPA-SADRTVIDYNGERTLDGFKKFLESGGQ--------DGAGDDDDLEDLEEAEEPDLE---EDDDQKAVKDEL 510          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_CHICK (Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3)

HSP 1 Score: 198.364 bits (503), Expect = 6.497e-50
Identity = 118/316 (37.34%), Postives = 177/316 (56.01%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSE--------------------VNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDGE-LTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLK 873
            + F++    D AK F L +E                    +++  +V+ KK  E  + F+G   K  + +F+ SN+LPLV  FT + AP +F   IK  +LLF   +  D E  L  F+ AA +FKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  + + LT DKIK F   FL GK+KP   S  +PE  D   VK++VG NF+E+  DE+K+V +E YAPWCGHC+   P ++KL +  R  ++IVIAKMD T NE    K   FPT+ FFPAG+   + I+ + +RT+    KFL+
Sbjct:  163 IGFFKDVTSDAAKEFLLAAESVDDIPFGISSSADVFSKYQLSQDGVVLFKKFDEGRNNFEGDLTKDNLLNFIKSNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLDNFKTAAGNFKGKILFIFIDSDHSD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDDLTADKIKEFCNKFLEGKIKPHLMSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYRDHENIVIAKMDSTANEVEAVKIHSFPTLKFFPAGS-GRNVIDYNGERTLEGFKKFLE 476          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_MACFU (Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.890e-49
Identity = 127/346 (36.71%), Postives = 187/346 (54.05%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDG-ELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDV--DRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            + F  T+N DV   + LD +     +V+ KK  E  + F+G+  K  + DF+  N+LPLV  FT + AP +F   IK  +LLF   +  D +  L  F+ AA+SFKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  +  ELT ++I  F   FL GK+KP   S  +PE  D   VK++VG NF+E+  DE+K+V +E YAPWCGHC+   P ++KL +  +  ++IVIAKMD T NE    K   FPT+ FFPA   S D   +D   +RT+    KFL+              A   +      +AE  D++   E    K VKDEL
Sbjct:  184 IPFGITSNSDVFSKYQLDKD----GVVLFKKFDEGRNNFEGEVTKENLLDFIKYNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAIKVHSFPTLKFFPA---SVDRTVIDYNGERTLDGFKKFLESGGQ--------DGAGDDDDLEDLEEAEEPDME---EDDDQKAVKDEL 510          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_HUMAN (Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 3.225e-49
Identity = 124/344 (36.05%), Postives = 186/344 (54.07%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDGE-LTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            + F  T+N DV   + LD +     +V+ KK  E  + F+G+  K  + DF+  N+LPLV  FT + AP +F   IK  +LLF   +  D +  L  F+ AA+SFKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  + E LT ++I  F   FL GK+KP   S  +PE  D   VK++VG NF+++  DE K+V +E YAPWCGHC+   P ++KL +  +  ++IVIAKMD T NE    K   FPT+ FFPA +     I+ + +RT+    KFL+              A   +      +AE  D++   E    K VKDEL
Sbjct:  182 IPFGITSNSDVFSKYQLDKD----GVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPA-SADRTVIDYNGERTLDGFKKFLESGGQ--------DGAGDDDDLEDLEEAEEPDME---EDDDQKAVKDEL 508          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_RAT (Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 5.500e-49
Identity = 114/296 (38.51%), Postives = 171/296 (57.77%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDG-ELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLK 873
            + F  T+N DV   + LD +     +V+ KK  E  + F+G+  K  + DF+  N+LPLV  FT + AP +F   IK  +LLF   +  D +  L  F++AA+ FKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  +  ELT +KI  F   FL GK+KP   S  +PE  D   VK++VG NF+E+  DE K+V +E YAPWCGHC+   P ++KL +  +  ++IVIAKMD T NE    K   FPT+ FFPA +     I+ + +RT+    KFL+
Sbjct:  184 IPFGITSNSDVFSKYQLDKD----GVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAEGFKGKILFIFIDSDHTD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITQFCHHFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPA-SADRTVIDYNGERTLDGFKKFLE 473          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_PONAB (Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 7.183e-49
Identity = 123/344 (35.76%), Postives = 186/344 (54.07%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDGE-LTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            + F  T+N DV   + LD +     +V+ KK  E  + F+G+  K  + DF+  N+LPLV  FT + AP +F   IK  +LLF   +  D +  L  F+ AA+SFKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  + E LT ++I  F   FL GK+KP   S  +P+  D   VK++VG NF+++  DE K+V +E YAPWCGHC+   P ++KL +  +  ++IVIAKMD T NE    K   FPT+ FFPA +     I+ + +RT+    KFL+              A   +      +AE  D++   E    K VKDEL
Sbjct:  182 IPFGITSNSDVFSKYQLDKD----GVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPA-SADRTVIDYNGERTLDGFKKFLESGGQ--------DGAGDDDDLEDLEEAEEPDME---EDDDQKAVKDEL 508          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_MOUSE (Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 6.081e-48
Identity = 121/344 (35.17%), Postives = 181/344 (52.62%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDG-ELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            + F  T+N  V   + LD +     +V+ KK  E  + F+G+  K  + DF+  N+LPLV  FT + AP +F   IK  +LLF   +  D +  L  F+ AA+ FKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  +  ELT +KI  F   FL GK+KP   S  +PE  D   VK++VG NF+E+  DE K+V +E YAPWCGHC+   P ++KL +  +  ++I+IAKMD T NE    K   FPT+ FFPA +     I+ + +RT+    KFL+          +     +  +P  E            E    K VKDEL
Sbjct:  184 IPFGITSNSGVFSKYQLDKD----GVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSDHTD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEAVKVHSFPTLKFFPA-SADRTVIDYNGERTLDGFKKFLESGGQDGAGDDEDLDLEEALEPDME------------EDDDQKAVKDEL 509          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_RABIT (Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 7.942e-48
Identity = 125/364 (34.34%), Postives = 187/364 (51.37%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSE--------------------VNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDG-ELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAESSDIKGSHESSSXKDVKDEL 1017
            + F++    D AK F L +E                    V++  +V+ KK  E  + F+G+  K  + DF+  N+LPLV  FT + AP +F   IK  +LLF   +  D +  L  F++AA+ FKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  +  ELT + I  F + FL GK+KP   S  +PE  D   VK++VG NF+E+  DE K+V +E YAPWCGHC+   P ++KL +  +    IVIAKMD T NE    K   FPT+ FFPAG      I+ + +RT+    KFL+              A   +      +AE  D++   E    K V+DEL
Sbjct:  159 IGFFKDVESDAAKQFLLAAEATDDIPFGLTASSDVFSRYQVHQDGVVLFKKFDEGRNNFEGEVTKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPRSAADHDGKLSGFKQAAEGFKGKILFIFIDSDHAD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEGITEFCQRFLEGKIKPHLMSQELPEDWDRQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKEHQDIVIAKMDSTANEVEAVKVHSFPTLKFFPAG-PGRTVIDYNGERTLDGFKKFLESGGQ--------DGAGDEDGLEDLEEAEEPDLE---EDDDQKAVRDEL 509          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDIA1_CRIGR (Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.355e-47
Identity = 112/296 (37.84%), Postives = 169/296 (57.09%), Query Frame = 1
Query:    1 VNFYQTTNPDVAKIFHLDSEVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSN--DSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGE-APKVLAYTGNDDAKKHILDG-ELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLK 873
            + F  T+N  V   + LD +     +V+ KK  E  + F+G+  K  + DF+  N+LPLV  FT + AP +F   IK  +LLF   +  D +  L  F++AA+ FKGK++F+++  D+ D  + + E+FG+  E  P V   T  ++  K+  +  ELT +KI  F   FL GK+KP   S  +PE  D   VK++VG NF+E+  DE K+V +E YAPWCGHC+   P ++KL +  +  ++I+IAKMD T NE    K   FPT+ FFPA       I+ + +RT+    KFL+
Sbjct:  184 IPFGITSNSGVFSKYQLDKD----GVVLFKKFDEGRNNFEGEVTKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLGNFKKAAEGFKGKILFIFIDSDHTD-NQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEAVKVHSFPTLKFFPA-TADRTVIDYNGERTLDGFKKFLE 473          
BLAST of DC900278 vs. ExPASy Swiss-Prot
Match: PDI2_CAEEL (Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.769e-47
Identity = 117/305 (38.36%), Postives = 170/305 (55.74%), Query Frame = 1
Query:   58 EVNRPALVMVKKEAEKISYFDGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSE--KLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGIT-GEAPKVLAYTGNDDAKKHILD-GELTLDKIKTFGEDFLAGKVKPFFKSDPIPETNDGD-VKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPASEPKAE 957
            E+    +V+ KK  +    FD K  +  +  ++ +N+L LV+ FT+E A  +F   IK+  LLF     SE  KL   F+ AAK FKGK++FVY+  D E+  + + E+FG+   E P +   +  +D  K   D  E+T + I  F +++L G VKP   S+ IPE  D + VKI+VG NF+++  D +K+VL+E YAPWCGHC+   PT++KL +     +SIVIAKMD T NE    K   FPTI FFPAG+     ++   DRT+    KFL+ N       ++   A + EK   E   E
Sbjct:  193 ELKGEGIVLFKKFDDGRVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENAR-IMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV--VDYTGDRTIEGFTKFLETNG------KEGAGASEEEKAEEEADEE 488          
The following BLAST results are available for this feature:
BLAST of DC900278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
PDIA1_BOVIN3.809e-5036.63Protein disulfide-isomerase OS=Bos taurus GN=P4HB ... [more]
PDIA1_CHICK6.497e-5037.34Protein disulfide-isomerase OS=Gallus gallus GN=P4... [more]
PDIA1_MACFU1.890e-4936.71Protein disulfide-isomerase OS=Macaca fuscata fusc... [more]
PDIA1_HUMAN3.225e-4936.05Protein disulfide-isomerase OS=Homo sapiens GN=P4H... [more]
PDIA1_RAT5.500e-4938.51Protein disulfide-isomerase OS=Rattus norvegicus G... [more]
PDIA1_PONAB7.183e-4935.76Protein disulfide-isomerase OS=Pongo abelii GN=P4H... [more]
PDIA1_MOUSE6.081e-4835.17Protein disulfide-isomerase OS=Mus musculus GN=P4h... [more]
PDIA1_RABIT7.942e-4834.34Protein disulfide-isomerase OS=Oryctolagus cunicul... [more]
PDIA1_CRIGR1.355e-4737.84Protein disulfide-isomerase OS=Cricetulus griseus ... [more]
PDI2_CAEEL1.769e-4738.36Protein disulfide-isomerase 2 OS=Caenorhabditis el... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900278 VSS Citrus sinensis cDNA clone VS28624 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900278 ID=DC900278|Name=DC900278|organism=Citrus sinensis|type=EST|length=1108bp
GTCAACTTCTATCAAACTACAAATCCTGATGTGGCAAAGATTTTCCACCT
TGATTCTGAAGTCAATCGCCCGGCTCTGGTCATGGTTAAGAAGGAGGCTG
AGAAAATAAGCTATTTTGATGGGAAATTTGATAAGTCTACTATTGCTGAT
TTTGTATTTTCAAACAAGCTTCCTTTAGTCACCATTTTTACAAGGGAAAA
TGCCCCTTCAGTTTTTGAAAGTCCAATTAAGAATCAGCTGCTATTGTTTG
CTGTTTCAAATGACTCAGAAAAGCTTTTACCAGTATTCGAAGAAGCCGCA
AAATCTTTCAAGGGAAAGCTTATTTTTGTGTATGTCCAAATGGACAATGA
AGATGTCGGAAAGCCTGTTTCAGAGTATTTTGGCATCACTGGGGAAGCTC
CCAAAGTTCTTGCATACACGGGGAATGATGACGCTAAAAAACATATCCTG
GATGGAGAGTTGACCTTGGATAAAATTAAGACTTTTGGAGAGGATTTCCT
CGCAGGCAAGGTTAAGCCTTTCTTTAAGTCTGATCCAATTCCAGAAACTA
ATGATGGAGATGTGAAAATAGTGGTTGGAAATAACTTTGATGAAATTGTC
TTGGATGAGTCAAAGGATGTTCTTCTGGAGATCTATGCCCCTTGGTGTGG
GCATTGCCAAGCCTTCGAGCCAACCTACAACAAACTGGCCAAACATCTAC
GTGGCGTTGATTCTATTGTTATCGCTAAGATGGATGGCACGACAAATGAA
CATCACAGGGCAAAGTCTGATGGATTCCCAACAATTCTTTTCTTCCCAGC
TGGAAACAAGAGTTTTGATCCTATCAATGTAGATGTTGACCGTACTGTGG
TGGCATTGTACAAGTTTCTTAAGAAAAATGCTTCAATCCCCTTTAAAATC
CAGAAGCCAACATCAGCACCCAAGACAGAGAAACCAGCTTCGGAACCAAA
AGCTGAGTCCTCGGATATCAAAGGGAGCCACGAGAGCAGTAGCGANAAAG
ATGTGAAGGACGAATTGTAACTTGCCTAAAACAAGGAAGATGATATACAA
CGGGTGTAATGCTAAANTTANTGTACACCTTTTATCAGTCATCAGGTACT
AGAAAGAA
back to top