DC900274

Overview
NameDC900274
Unique NameDC900274
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length779
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: OPD22_ARATH (Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=1 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 1.217e-40
Identity = 81/105 (77.14%), Postives = 92/105 (87.62%), Query Frame = 3
Query:   39 VAQKPX-HQLEPQDYEGGT-SQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +AQK   + L+P+DYEGGT +   LGGPFGIKQFCA+INPPQ+ ILA+GSAEKRV+PG GPDQY  +S+MSVTLSCDHRVIDGAIGAEWLKAFKGYIE PESMLL
Sbjct:  435 LAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVINPPQAAILAIGSAEKRVVPGTGPDQYNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL 539          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: OPD23_ARATH (Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 2.712e-40
Identity = 79/105 (75.24%), Postives = 93/105 (88.57%), Query Frame = 3
Query:   39 VAQKPX-HQLEPQDYEGGT-SQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +AQK   + L+P+DYEGGT +   LGGPFGIKQFCA++NPPQ+ ILAVGSAEKRV+PG GPDQ+ F+S+M VTLSCDHRV+DGAIGAEWLKAFKGYIENP+SMLL
Sbjct:  435 LAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVVNPPQAAILAVGSAEKRVVPGNGPDQFNFASYMPVTLSCDHRVVDGAIGAEWLKAFKGYIENPKSMLL 539          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_DICDI (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=2 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 5.490e-25
Identity = 55/97 (56.70%), Postives = 71/97 (73.20%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQ-YKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L P ++E GT      G  GIKQF A+INPPQ+ ILAVG+ E RV+    PD  Y+ ++ +SVTLSCDHRVIDGA+GAEWLK+FK Y+ENP  ++L
Sbjct:  539 KLHPSEFESGTFTISNLGMLGIKQFAAVINPPQAAILAVGTTETRVVLSNKPDSPYETATILSVTLSCDHRVIDGAVGAEWLKSFKDYVENPIKLIL 635          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_RAT (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3)

HSP 1 Score: 111.309 bits (277), Expect = 6.069e-24
Identity = 52/96 (54.17%), Postives = 70/96 (72.92%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L+P +++GGT      G FGIK F AIINPPQ+ ILA+G++E ++IP      +  +S MSVTLSCDHRV+DGA+GA+WL  FK Y+E P +MLL
Sbjct:  537 KLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPVTMLL 632          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_MOUSE (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 7.927e-24
Identity = 52/96 (54.17%), Postives = 70/96 (72.92%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L+P +++GGT      G FGIK F AIINPPQ+ ILA+G++E ++IP      +  +S MSVTLSCDHRV+DGA+GA+WL  FK Y+E P +MLL
Sbjct:  547 KLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMLL 642          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_HUMAN (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3)

HSP 1 Score: 109.768 bits (273), Expect = 1.766e-23
Identity = 50/96 (52.08%), Postives = 70/96 (72.92%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L+P +++GGT      G FGIK F AIINPPQ+ ILA+G++E +++P      +  +S MSVTLSCDHRV+DGA+GA+WL  F+ Y+E P +MLL
Sbjct:  552 KLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL 647          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_RICBR (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 5.317e-20
Identity = 51/97 (52.58%), Postives = 68/97 (70.10%), Query Frame = 3
Query:   57 HQLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            ++L P++++GG       G +GIK F AIINPPQS I+ VGS+ KR I  +  DQ   ++ M VTLS DHRV+DGA+GAE+L AFK +IE+P  MLL
Sbjct:  321 NKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGSSSKRAI--VKNDQISIATIMDVTLSADHRVVDGAVGAEFLAAFKRFIESPALMLL 415          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_RHIME (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rhizobium meliloti GN=pdhC PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.020e-19
Identity = 47/96 (48.96%), Postives = 67/96 (69.79%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L+P++Y+GGT+     G  G+K F A++NPP + ILAVG+ E RV+  +   +   ++ M+VTLS DHR +DGA+GAE L AFK YIENP  ML+
Sbjct:  354 KLKPEEYQGGTTAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVV--VRNKEMVIANVMTVTLSTDHRCVDGALGAELLAAFKRYIENPMGMLV 447          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_CAEEL (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.020e-19
Identity = 48/97 (49.48%), Postives = 65/97 (67.01%), Query Frame = 3
Query:   60 QLEPQDYEGGTSQYQLGGPFG-IKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            +L+P +++GGT      G FG +  F AIINPPQS ILA+G A  +++P    + YK    M VTLSCDHR +DGA+GA WL+ FK ++E P +MLL
Sbjct:  412 KLQPHEFQGGTFTVSNLGMFGSVSDFTAIINPPQSCILAIGGASDKLVPDEA-EGYKKIKTMKVTLSCDHRTVDGAVGAVWLRHFKEFLEKPHTMLL 507          
BLAST of DC900274 vs. ExPASy Swiss-Prot
Match: ODP2_RICFE (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia felis GN=pdhC PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.639e-19
Identity = 49/105 (46.67%), Postives = 71/105 (67.62%), Query Frame = 3
Query:   33 QTVAQKPXHQLEPQDYEGGTSQYQLGGPFGIKQFCAIINPPQSGILAVGSAEKRVIPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 347
            + + +   ++L P++++GG       G +GIK F AIINPPQS I+ VG++ KR I  +  DQ   ++ M VTLS DHRV+DGA+GAE+L AFK +IE+P  ML+
Sbjct:  310 ELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGASAKRAI--VKNDQVTIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPALMLI 412          
The following BLAST results are available for this feature:
BLAST of DC900274 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
OPD22_ARATH1.217e-4077.14Dihydrolipoyllysine-residue acetyltransferase comp... [more]
OPD23_ARATH2.712e-4075.24Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_DICDI5.490e-2556.70Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RAT6.069e-2454.17Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_MOUSE7.927e-2454.17Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_HUMAN1.766e-2352.08Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICBR5.317e-2052.58Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RHIME2.020e-1948.96Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_CAEEL2.020e-1949.48Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICFE2.639e-1946.67Dihydrolipoyllysine-residue acetyltransferase comp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900274 VSS Citrus sinensis cDNA clone VS28618 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900274 ID=DC900274|Name=DC900274|organism=Citrus sinensis|type=EST|length=779bp
AGCTACAAAAAGGCTATCCCAATGCTAANAGTCAGACAGTGGCCCAAAAG
CCAAGNCACCAGCTTGAACCCCAAGATTATGAGGGAGGCACATCNCAGTA
CCAATTGGGAGGACCCTTCGGCATCAAGCAATTCTGTGCCATTATCAATC
CTCCTCAATCTGGCATTCTTGCAGTTGGATCTGCTGAGAAAAGGGTTATC
CCTGGCTTGGGTCCAGATCAGTATAAATTTTCTTCCTTCATGTCAGTAAC
ATTAAGTTGTGATCATCGCGTAATAGATGGTGCGATTGGTGCTGAATGGT
TGAAAGCATTCAAAGGATACATTGAGAATCCGGAGTCCATGTTGCTATAA
GCCAAACTTGTCTTTTTCTAAGTTGAGAAGCTCTTTCCTAGCTGTATCAG
TTTAGATGGGGGCTTCAGTTCAACCCCTTCCACCTGGGATCAGATTGGCA
TGGTTGTGTCACTGAGCACATCTTGATTTTGTTTTTCAATTGGTAAACAC
TTTTAAGCAAAAATTTTGGAATAAAAGCAGGGGATCGAGGCACGAAACCA
ATCCTTAAACTCATACTCATCCTTGATAGGGTGTTCAACAAGGTGNTCTG
CTATCGCCGTTTCCTTAATGGATTTTTGGGTTACATACGTGATGAACATG
ATTTTAGTAGAGTGTAATCGCCTCTTTCATGCGGGTAATAATTTGATTTA
TATATAATTTTTGGATTTTCCAATTACCAGTGTTGTGTGAAACAACACTT
ATATTAATTTGATAAACCTGTATTCTTGT
back to top