DC900273

Overview
NameDC900273
Unique NameDC900273
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length757
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: OPD22_ARATH (Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=1 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 1.271e-79
Identity = 158/235 (67.23%), Postives = 172/235 (73.19%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXXIXTXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGL 707
            VGEVIAITVE+E+DI KFKDY+PS SD G                                      DR+FASP+AR LAE++NV LS IKGTGP G IVKAD+ED+LAS  KE  AK  K  D   PALDYVDIPH+QIRK+TASRL FSKQTIPHYYLTVD CVD +MGLR+QLNS QEAS GKRISVNDLVIKAAALALRKVP+CNSSW DEYIRQFKNVNINVAVQTENGL
Sbjct:  179 VGEVIAITVEDEDDIQKFKDYTPS-SDTGPAAPEAKPAPSLPKEEKVEKPASAPEAKISKPSSAPSEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLASGSKETTAKPSKQVDSKVPALDYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTCVDKMMGLRSQLNSFQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKNVNINVAVQTENGL 412          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: OPD23_ARATH (Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=1 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.299e-77
Identity = 156/235 (66.38%), Postives = 171/235 (72.77%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXXIXTXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGL 707
            VGEVIAITVE+EEDI KFKDY+PS S A                                       DR+FASP+AR LAE++NV LS I+GTGP G IVKADI++YLAS GK   AK  K  D  APALDYVDIPHSQIRK+TASRL FSKQTIPHYYLTVD CVD LM LR+QLNS +EAS GKRISVNDLV+KAAALALRKVP+CNSSW D+YIRQFKNVNINVAVQTENGL
Sbjct:  179 VGEVIAITVEDEEDIGKFKDYTPS-STADAAPTKAEPTPAPPKEEKVKQPSSPPEPKASKPSTPPTGDRVFASPLARKLAEDNNVPLSDIEGTGPEGRIVKADIDEYLASSGKGATAKPSKSTDSKAPALDYVDIPHSQIRKVTASRLAFSKQTIPHYYLTVDTCVDKLMALRSQLNSFKEASGGKRISVNDLVVKAAALALRKVPQCNSSWTDDYIRQFKNVNINVAVQTENGL 412          

HSP 2 Score: 23.483 bits (49), Expect = 1.299e-77
Identity = 9/11 (81.82%), Postives = 10/11 (90.91%), Query Frame = 2
Query:  707 YVPVXRDADRK 739
            YVPV +DADRK
Sbjct:  413 YVPVVKDADRK 423          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_SCHPO (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe GN=SPCC794.07 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.270e-36
Identity = 96/245 (39.18%), Postives = 136/245 (55.51%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXXIXTXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDY----LASRGKEVPAKAP----KGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            VG+ +A+TVE E D+    D++   S A                        +              DR+FASP+AR LAEE ++ LS I+G+GPNG I+K DIE++          E  AKA        D  AP  DY D+P S +RKI ASRL  SK   PHYY+TV + ++ ++ LR  LN++  A    ++SVNDLVIKA   ALR+VP  N++W  ++IRQ+KNV+I++AV T +GL++
Sbjct:  121 VGKPLAVTVENEGDVAAMADFTIEDSSAKEPSAKSGEEKSAPSSEKQSKETSSPSNVSGEERG----DRVFASPLARKLAEEKDLDLSQIRGSGPNGRIIKVDIENFKPVVAPKPSNEAAAKATTPAASAADAAAPG-DYEDLPLSNMRKIIASRLAESKNMNPHYYVTVSVNMEKIIRLRAALNAM--ADGRYKLSVNDLVIKATTAALRQVPEVNAAWMGDFIRQYKNVDISMAVATPSGLIT 358          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_RAT (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3)

HSP 1 Score: 150.599 bits (379), Expect = 8.625e-36
Identity = 92/239 (38.49%), Postives = 131/239 (54.81%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXXIXTXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKA-PKGKDVV-APALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            +G  + I VE++EDI  F DY P+   +                      I                 R+F SP+A+ LA E  + L+ +KGTGP G I+K DI+ ++ ++     A A P G  V   PA  ++DIP S IR++ A RL+ SKQTIPHYYL+VD+ +  ++ +R +LN + E     +ISVND +IKA+ALA  KVP  NSSW D  IRQ   V+++VAV T  GL++
Sbjct:  276 LGTPLCIIVEKQEDIAAFADYRPTEVTS----LKPQAPPPVPPPVAAVPPIPQPLAPTPSAAPAGPKGRVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPTKAAPAAAAAAPPGPRVAPTPAGVFIDIPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLEGKG--KISVNDFIIKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLIT 508          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_MOUSE (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 1.126e-35
Identity = 93/240 (38.75%), Postives = 131/240 (54.58%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXXIXTXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKA--PKGKDVV-APALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            +G  + I VE++EDI  F DY P+   +                      +                 R+F SP+A+ LA E  + L+ +KGTGP G I+K DI+ ++ S+     A A  P G  V  APA  + DIP S IR++ A RL+ SKQTIPHYYL+VD+ +  ++ +R +LN + E     +ISVND +IKA+ALA  KVP  NSSW D  IRQ   V+++VAV T  GL++
Sbjct:  285 LGAPLCIIVEKQEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPVAPTPSAAPAGPKG----RVFVSPLAKKLAAEKGIDLTQVKGTGPEGRIIKKDIDSFVPSKAAPAAAAAMAPPGPRVAPAPAGVFTDIPISNIRRVIAQRLMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLEGKG--KISVNDFIIKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLIT 518          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_DICDI (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=2 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 1.126e-35
Identity = 88/243 (36.21%), Postives = 129/243 (53.09%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXXIXTXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYL------ASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            + + + I V+ +ED  KF DYS     +                        T              +R+FA+P AR  A      LS I GTGPN  I+KAD+ +++      A + ++      K       + ++ DIPHS IRK+TA+RL  SKQTIPHYYLT++  VD L+ LR++LN++       +ISVND ++KA+A ALR  P  NS+W D++IR++ N++INVAV T  GL +
Sbjct:  275 INQPVCIIVKNKEDCDKFADYSVEEQSSSSSSSSQESTPSSSSSSSQES---TPSQSSSQQTTRKSGERIFATPAARFEASSKGYDLSAINGTGPNNRILKADVLEFVPQKQEVAQQQQQQTTTTTKKPTTPTSSGEFTDIPHSNIRKVTAARLTESKQTIPHYYLTMECRVDKLLKLRSELNAMNTV----KISVNDFIVKASAAALRDNPVVNSTWTDQFIRRYHNIDINVAVNTPQGLFT 510          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_HUMAN (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3)

HSP 1 Score: 147.902 bits (372), Expect = 5.591e-35
Identity = 90/240 (37.50%), Postives = 128/240 (53.33%), Query Frame = 3
Query:    3 VGEVIAITVEEEEDIPKFKDYSPSVSDAGXXXXXXXXXXXXXXXXXXXXXIXTXXXXXXXXXXXXXXDRLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKA--PKGKDVV-APALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            +G  + I VE+E DI  F DY P+                          +                 R+F SP+A+ LA E  + L+ +KGTGP+G I K DI+ ++ S+    PA    P G  +   P   + DIP S IR++ A RL+ SKQTIPHYYL++D+ +  ++ +R +LN I E  +  +ISVND +IKA+ALA  KVP  NSSW D  IRQ   V+++VAV T  GL++
Sbjct:  286 LGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVFTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRS--KISVNDFIIKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLIT 523          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_RICCN (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia conorii GN=pdhC PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 6.834e-33
Identity = 73/170 (42.94%), Postives = 109/170 (64.12%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRG-KEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            R+FASP+A+ LA+  N+    +KG+GP+G IVK DI  Y  S    ++ ++ P+         +Y  +P++ IRKI A RLL SKQT+PH+YL+++  VD L+ +R  +N         RISVND +I A A AL++VP  N+SW ++ IR + NV+I+VAV  ENGL++
Sbjct:  130 RIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSRNPE---------EYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKFFSEDKSTRISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVT 290          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_RICBR (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.868e-32
Identity = 75/169 (44.38%), Postives = 110/169 (65.09%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASRGKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            ++FASP+A+ LA+  NV +  IKG+GP+G I+K D+   L+ +G    +KA   K V     +Y   P++ IRKI A RLL SKQT+PH+YL+++  VD L+ +R  +N         +ISVND +I A A AL++VP  N+SW D+ IR + NV+I+VAV  ENGL++
Sbjct:  131 KVFASPLAKRLAKIQNVRIEEIKGSGPHGRIIKQDV---LSHKGG---SKALSNKIVSRNPEEYRLAPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFGDDKSAKISVNDFIILAVAKALQEVPNANASWGDDAIRYYNNVDISVAVAIENGLVT 293          
BLAST of DC900273 vs. ExPASy Swiss-Prot
Match: ODP2_RICFE (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia felis GN=pdhC PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.683e-31
Identity = 72/170 (42.35%), Postives = 109/170 (64.12%), Query Frame = 3
Query:  207 RLFASPVARNLAEEHNVSLSIIKGTGPNGLIVKADIEDYLASR-GKEVPAKAPKGKDVVAPALDYVDIPHSQIRKITASRLLFSKQTIPHYYLTVDICVDNLMGLRNQLNSIQEASAGKRISVNDLVIKAAALALRKVPRCNSSWADEYIRQFKNVNINVAVQTENGLMS 713
            ++FASP+A+ LA+  N+ L  +KG+GP+G IVK DI  Y  S    ++ ++ P+         +Y  +P++ IRKI A RLL SKQT+PH+YL+++  VD L+ +R  +N         RISVND +I A A AL+++P  N+SW ++ IR   NV+I+VAV  ENGL++
Sbjct:  130 KIFASPLAKRLAKMGNIRLESVKGSGPHGRIVKQDILSYTPSTVHNKIVSRNPE---------EYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKSTRISVNDFIILAVAKALQELPNANASWGEDAIRYHNNVDISVAVAIENGLVT 290          
The following BLAST results are available for this feature:
BLAST of DC900273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
OPD22_ARATH1.271e-7967.23Dihydrolipoyllysine-residue acetyltransferase comp... [more]
OPD23_ARATH1.299e-7766.38Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_SCHPO2.270e-3639.18Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RAT8.625e-3638.49Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_MOUSE1.126e-3538.75Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_DICDI1.126e-3536.21Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_HUMAN5.591e-3537.50Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICCN6.834e-3342.94Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICBR9.868e-3244.38Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICFE1.683e-3142.35Dihydrolipoyllysine-residue acetyltransferase comp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900273 VSS Citrus sinensis cDNA clone VS28618 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900273 ID=DC900273|Name=DC900273|organism=Citrus sinensis|type=EST|length=757bp
AAGTTGGTGAGGTTATTGCTATCACTGTTGAAGAAGAGGAAGATATTCCG
AAGTTTAAAGATTACAGTCCTTCAGTGTCTGATGCTGGTGCTGCTCCAGC
TAAAGAGCCTTCTCCTCCTCCCCCTCCAAAACAGGAAGAGGTTGAAAAAC
CAATCNGTACATCAGAGCCAAAGGCCTCTAAACCCAGTGCAGCTTCTCCT
GAAGATCGCCTTTTTGCTAGTCCTGTTGCTAGGAATTTGGCTGAAGAACA
TAATGTTTCCCTCTCCATCATCAAGGGAACAGGTCCCAATGGACTCATTG
TGAAGGCTGATATTGAAGATTACTTGGCTTCTCGTGGGAAAGAAGTTCCA
GCCAAAGCTCCTAAGGGTAAGGACGTTGTGGCCCCAGCTTTGGACTATGT
TGACATCCCTCATTCTCAAATAAGAAAGATCACTGCTTCACGCTTGTTGT
TCTCAAAGCAAACAATCCCACATTATTATTTAACAGTCGATATATGTGTT
GACAATCTCATGGGTTTGCGAAACCAACTCAATTCCATACAAGAGGCTTC
GGCTGGAAAGCGGATATCTGTTAATGATCTGGTGATTAAGGCTGCAGCCT
TGGCTCTGCGAAAAGTGCCTCGGTGCAATAGTTCATGGGCTGATGAATAT
ATCCGACAATTTAAGAATGTGAATATTAATGTAGCAGTGCAGACAGAAAA
CGGTCTTATGTCCCAGTTNTAAGGGATGCTGACAGAAAGGCTTATCCNCA
TTGCTGA
back to top