DC900270

Overview
NameDC900270
Unique NameDC900270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6850 contig Csv1_Contig6850:509..1393. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU1_SOYBN (Elongation factor Tu, chloroplastic OS=Glycine max GN=TUFA PE=3 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 6.223e-79
Identity = 146/158 (92.41%), Postives = 153/158 (96.84%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TVDLVGL+ETRN TVTGVEMFQK LDEA+AGDNVGLLLRGVQK DIQRGMVLAKPGTITPHTKF AIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTG+V+SIMNDKDEES MV+PGDR+KMVVELI+PVACEQGMRFAIREGGKTVGAGVIQSIIE
Sbjct:  322 TVDLVGLRETRNTTVTGVEMFQKILDEALAGDNVGLLLRGVQKTDIQRGMVLAKPGTITPHTKFSAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTSIMNDKDEESTMVLPGDRVKMVVELIVPVACEQGMRFAIREGGKTVGAGVIQSIIE 479          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU2_SOYBN (Elongation factor Tu, chloroplastic OS=Glycine max GN=TUFB1 PE=3 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 4.033e-78
Identity = 142/158 (89.87%), Postives = 153/158 (96.84%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TVD+VG+K+TRN TVTGVEMFQK LDEA+AGDNVGLLLRG+QK DIQRGMVLAKPGTITPHTKF AIVYVLKKEEGGRHSPFF+GYRPQFYMRTTDVTG+V+ IMNDKDEESKMVMPGDR+K+VVELI+PVACEQGMRFAIREGGKTVGAGVIQSIIE
Sbjct:  322 TVDIVGVKDTRNTTVTGVEMFQKILDEALAGDNVGLLLRGIQKTDIQRGMVLAKPGTITPHTKFSAIVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGKVTEIMNDKDEESKMVMPGDRVKLVVELIVPVACEQGMRFAIREGGKTVGAGVIQSIIE 479          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ARATH (Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 2.614e-77
Identity = 140/158 (88.61%), Postives = 154/158 (97.47%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TVDLVGL+ETR++TVTGVEMFQK LDEA+AGDNVGLLLRG+QKADIQRGMVLAKPG+ITPHTKF AI+YVLKKEEGGRHSPFFAGYRPQFYMRTTDVTG+V+ IMNDKDEESKMVMPGDR+K+VVELI+PVACEQGMRFAIREGGKTVGAGVI +I+E
Sbjct:  319 TVDLVGLRETRSYTVTGVEMFQKILDEALAGDNVGLLLRGIQKADIQRGMVLAKPGSITPHTKFEAIIYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTKIMNDKDEESKMVMPGDRVKIVVELIVPVACEQGMRFAIREGGKTVGAGVIGTILE 476          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTUB_NICSY (Elongation factor TuB, chloroplastic OS=Nicotiana sylvestris GN=TUFB PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 4.930e-76
Identity = 140/157 (89.17%), Postives = 149/157 (94.90%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            VD+VGLK+TRN TVTGVEMFQK LDEAMAGDNVGLLLRG+QK DIQRGMVLAKPGTITPHTKF A+VYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTG+V+ IM+DK EESKMVMPGDR+ MVVELIMPVACEQGMRFAIREGGKTVGAGVIQ I+E
Sbjct:  329 VDIVGLKDTRNTTVTGVEMFQKILDEAMAGDNVGLLLRGIQKIDIQRGMVLAKPGTITPHTKFEALVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTVIMSDKGEESKMVMPGDRVNMVVELIMPVACEQGMRFAIREGGKTVGAGVIQKILE 485          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_PEA (Elongation factor Tu, chloroplastic OS=Pisum sativum GN=tufA PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 6.439e-76
Identity = 141/157 (89.81%), Postives = 151/157 (96.18%), Query Frame = 3
Query:    6 VDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            VDLVGL+ETRN TVTGVEMFQK LD+AMAGDNVGLLLRG+QK DIQRGMVLAKPGTITPH+KF AIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTG+V+SIMNDKDEESKMVMPGDR+K+VVELI+PVA EQGMRFAIREGGKTVGAGVI +IIE
Sbjct:  332 VDLVGLRETRNTTVTGVEMFQKILDDAMAGDNVGLLLRGIQKIDIQRGMVLAKPGTITPHSKFSAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTSIMNDKDEESKMVMPGDRVKIVVELIVPVAIEQGMRFAIREGGKTVGAGVIGAIIE 488          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_TOBAC (Elongation factor Tu, chloroplastic OS=Nicotiana tabacum GN=TUFA PE=3 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 1.098e-75
Identity = 140/158 (88.61%), Postives = 149/158 (94.30%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TVD+VGLK+TR+ TVTGVEMFQK LDEAMAGDNVGLLLRG+QK DIQRGMVLAKPGTITPHTKF AIVYVLKKEEGGRHSPFF+GYRPQFYMRTTDVTG+V+SI  DK EESKMVMPGDR+ +VVELIMPVACEQGMRFAIREGGKTVGAGVIQ IIE
Sbjct:  321 TVDIVGLKDTRSTTVTGVEMFQKILDEAMAGDNVGLLLRGIQKIDIQRGMVLAKPGTITPHTKFEAIVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGKVTSITTDKGEESKMVMPGDRVNLVVELIMPVACEQGMRFAIREGGKTVGAGVIQKIIE 478          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTUA_NICSY (Elongation factor TuA, chloroplastic OS=Nicotiana sylvestris GN=TUFA PE=2 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 1.098e-75
Identity = 140/158 (88.61%), Postives = 149/158 (94.30%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TVD+VGLK+TR+ TVTGVEMFQK LDEAMAGDNVGLLLRG+QK DIQRGMVLAKPGTITPHTKF AIVYVLKKEEGGRHSPFF+GYRPQFYMRTTDVTG+V+SI  DK EESKMVMPGDR+ +VVELIMPVACEQGMRFAIREGGKTVGAGVIQ IIE
Sbjct:  321 TVDIVGLKDTRSTTVTGVEMFQKILDEAMAGDNVGLLLRGIQKIDIQRGMVLAKPGTITPHTKFEAIVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGKVTSITTDKGEESKMVMPGDRVNLVVELIMPVACEQGMRFAIREGGKTVGAGVIQKIIE 478          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_LEPTE (Elongation factor Tu, chloroplastic OS=Leptosira terrestris GN=tufA PE=3 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.538e-64
Identity = 113/157 (71.97%), Postives = 141/157 (89.81%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSII 473
            T+++VGL+ETR  TVTG+EMFQKTL+E++AGDNVG+LLRG+QK DIQRGMVLAKPG+ITPHTKF A VY+L ++EGGRH+PFFAGYRPQFY+RTTDVTG++ +   D D+ ++MVMPGDRIKM VELI P+A E+GMRFAIREGG+TVGAGV+ +I+
Sbjct:  252 TIEIVGLRETRTTTVTGLEMFQKTLEESVAGDNVGVLLRGIQKIDIQRGMVLAKPGSITPHTKFTAQVYILTRDEGGRHTPFFAGYRPQFYVRTTDVTGKIETFRTDDDQPTQMVMPGDRIKMEVELIQPIAIEKGMRFAIREGGRTVGAGVVSAIV 408          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_ACAM1 (Elongation factor Tu OS=Acaryochloris marina (strain MBIC 11017) GN=tuf PE=3 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 4.329e-64
Identity = 117/158 (74.05%), Postives = 139/158 (87.97%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            TV+LVG+++TR+ TVTGVEMFQKTLDE MAGDNVGLLLRGVQK DI+RGMVLAKPG+ITPHT+F + VY+LKK+EGGRH+PFF GYRPQFY+RTTDVTG +S+   D    ++MVMPGDRIKM VELI P+A EQGMRFAIREGG+TVGAGV+  I++
Sbjct:  252 TVELVGIRDTRSTTVTGVEMFQKTLDEGMAGDNVGLLLRGVQKEDIERGMVLAKPGSITPHTQFESEVYILKKDEGGRHTPFFPGYRPQFYVRTTDVTGTISAFTADDGSAAEMVMPGDRIKMTVELINPIAIEQGMRFAIREGGRTVGAGVVSKILK 409          
BLAST of DC900270 vs. ExPASy Swiss-Prot
Match: EFTU_SYNP6 (Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tuf PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 5.654e-64
Identity = 115/158 (72.78%), Postives = 138/158 (87.34%), Query Frame = 3
Query:    3 TVDLVGLKETRNFTVTGVEMFQKTLDEAMAGDNVGLLLRGVQKADIQRGMVLAKPGTITPHTKFLAIVYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGRVSSIMNDKDEESKMVMPGDRIKMVVELIMPVACEQGMRFAIREGGKTVGAGVIQSIIE 476
            T+++VGL++TR+ TVTGVEMFQKTLDE +AGDNVGLLLRG+QK DI+RGMVLAKPG+ITPHTKF + VYVLKKEEGGRH+PFF GYRPQFY+RTTDVTG +S    D    ++MV+PGDRIKM VELI P+A EQGMRFAIREGG+T+GAGV+  I++
Sbjct:  252 TIEIVGLRDTRSTTVTGVEMFQKTLDEGLAGDNVGLLLRGIQKTDIERGMVLAKPGSITPHTKFESEVYVLKKEEGGRHTPFFPGYRPQFYVRTTDVTGAISDFTADDGSAAEMVIPGDRIKMTVELINPIAIEQGMRFAIREGGRTIGAGVVSKILQ 409          
The following BLAST results are available for this feature:
BLAST of DC900270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EFTU1_SOYBN6.223e-7992.41Elongation factor Tu, chloroplastic OS=Glycine max... [more]
EFTU2_SOYBN4.033e-7889.87Elongation factor Tu, chloroplastic OS=Glycine max... [more]
EFTU_ARATH2.614e-7788.61Elongation factor Tu, chloroplastic OS=Arabidopsis... [more]
EFTUB_NICSY4.930e-7689.17Elongation factor TuB, chloroplastic OS=Nicotiana ... [more]
EFTU_PEA6.439e-7689.81Elongation factor Tu, chloroplastic OS=Pisum sativ... [more]
EFTU_TOBAC1.098e-7588.61Elongation factor Tu, chloroplastic OS=Nicotiana t... [more]
EFTUA_NICSY1.098e-7588.61Elongation factor TuA, chloroplastic OS=Nicotiana ... [more]
EFTU_LEPTE2.538e-6471.97Elongation factor Tu, chloroplastic OS=Leptosira t... [more]
EFTU_ACAM14.329e-6474.05Elongation factor Tu OS=Acaryochloris marina (stra... [more]
EFTU_SYNP65.654e-6472.78Elongation factor Tu OS=Synechococcus sp. (strain ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900270 VSS Citrus sinensis cDNA clone VS28614 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900270 ID=DC900270|Name=DC900270|organism=Citrus sinensis|type=EST|length=885bp
AGACTGTTGATCTTGTGGGATTGAAGGAAACTAGGAATTTCACTGTAACT
GGGGTTGAAATGTTTCAAAAGACTCTAGACGAGGCAATGGCTGGGGATAA
TGTCGGGTTGTTACTTAGAGGTGTACAAAAGGCTGATATTCAGAGAGGGA
TGGTGTTGGCCAAGCCCGGAACAATTACTCCCCATACTAAGTTCCTTGCC
ATTGTGTATGTGTTGAAGAAGGAAGAAGGTGGTAGGCACTCACCTTTCTT
TGCGGGTTACAGGCCTCAATTTTACATGAGGACCACTGATGTGACTGGAA
GGGTGTCTTCTATTATGAACGACAAGGACGAGGAGTCCAAGATGGTTATG
CCTGGTGACCGTATCAAGATGGTTGTGGAGCTTATTATGCCAGTGGCTTG
TGAGCAAGGGATGAGATTTGCCATCAGAGAAGGAGGAAAGACTGTTGGAG
CTGGTGTTATTCAGTCCATCATTGAATGATAGTACTAGGAACTTTCATGG
GCAGTGGATTATCTTTTACTTTTTTGAGCGGTGTTAAACTTCATATTCTT
AAGTTTTTATGGAATTAGTTTCACCATTCTAGGAACTTCCAGAACCTAAT
GTCATATAATTTGCAGTTTTGTTCTTATTTTGCATTGAACTCATGTCAAG
TCTAGTTGGAAAATGTTCATGTGATAATTCAATATGACTCACTTTTCCTC
AGTTGCTTCAGCTAATGTTGATTTGCCTGTGGTCAATATTTCAACATAAG
AAAGAAAAAGTTCTGGTATGTCTGATGGTGCTTATCAGCAACTTGTTATT
GTTTTCTAACTATGTTGAATATTGATAAAATATTTGTGGTTGGGTGCTCC
TTTTAGTTCAACCCAACTTATATTCATGGTTGAAT
back to top