DC900268

Overview
NameDC900268
Unique NameDC900268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10954 contig Csv1_Contig10954:23..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPH_CATRO (Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 3.896e-82
Identity = 146/172 (84.88%), Postives = 153/172 (88.95%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            MPNP+VFFDM+VGGQPAGRIVMELFAD TPRTAENFRALCTGEKG G+SGKPLHYK SSFHRVIPGFMCQ            ESIYG+KFADENF+KKHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRT K VV+ DCGQLS
Sbjct:    1 MPNPRVFFDMSVGGQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQLS 172          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPH_SOLLC (Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.810e-79
Identity = 139/171 (81.29%), Postives = 150/171 (87.72%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NPKVFFD+T+GG PAGR+VMELFAD TP+TAENFRALCTGEKG+GK GKPLHYKGS+FHRVIPGFMCQ            ESIYG+KF DENFVKKHTGPGILSMANAGPGTNGSQFF+CTAKTEWL+GKHVVFGQVVEGMDV+K  E VGSSSGR +KPVVIADCGQL
Sbjct:    1 MANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL 171          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPH_LUPLU (Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 6.437e-77
Identity = 133/172 (77.33%), Postives = 149/172 (86.63%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            M NPKVFFDM + G PAGRIVMEL+AD TPRTAENFRALCTGEKG+G+SGKPLHYKGS+FHRVIP FMCQ            ESIYG+KFADENF+K+HTGPGILSMANAG GTNGSQFF+CT KTEWLDGKHVVFG+V+EGM+VV+ IEKVGS SG+T++PV IADCGQLS
Sbjct:    1 MSNPKVFFDMAIAGNPAGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSTFHRVIPNFMCQGGDFTAGNGTGAESIYGAKFADENFIKRHTGPGILSMANAGAGTNGSQFFICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSGKTSRPVTIADCGQLS 172          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP19A_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana GN=CYP19-1 PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 7.117e-76
Identity = 135/170 (79.41%), Postives = 146/170 (85.88%), Query Frame = 3
Query:   51 NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            NPKV+FDMTVGG+ AGRIVMEL+AD TP TAENFRALCTGE+GIGK GKPLHYKGSSFHRVIP FMCQ            ESIYGSKF DENF+KKHTGPGILSMANAG  TNGSQFF+CT KT WLDGKHVVFGQVVEG++VV+ IEKVGS SGRT+KPVVIADCGQ+S
Sbjct:    4 NPKVYFDMTVGGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHRVIPKFMCQGGDFTAGNGTGGESIYGSKFKDENFIKKHTGPGILSMANAGANTNGSQFFICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCGQIS 173          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP19B_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 4.613e-75
Identity = 130/170 (76.47%), Postives = 147/170 (86.47%), Query Frame = 3
Query:   51 NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            +PKVFFDMT+GG PAG+IVMEL+ D TP+TAENFRALCTGEKG+G+SGKPLH+KGSSFHRVIP FMCQ            ESIYG+KF DENF +KHTGPGILSMANAG  TNGSQFF+CT KT+WLDGKHVVFGQVVEG+DVVKAIEK+GSSSG+  KPVVIADCG++S
Sbjct:    4 HPKVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSFHRVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGKPTKPVVIADCGEIS 173          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP18C_ARATH (Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana GN=CYP18-3 PE=1 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 6.025e-75
Identity = 133/172 (77.33%), Postives = 145/172 (84.30%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            M  PKV+FDMT+ GQPAGRIVMEL+ D TPRTAENFRALCTGEKG+G +GKPLH+KGS FHRVIP FMCQ            ESIYGSKF DENF +KHTGPGILSMANAG  TNGSQFF+CT KT+WLDGKHVVFGQVVEG+DVVKAIEKVGSSSG+  KPVV+ADCGQLS
Sbjct:    1 MAFPKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKFHRVIPNFMCQGGDFTAGNGTGGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQLS 172          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPH_BRANA (Peptidyl-prolyl cis-trans isomerase OS=Brassica napus GN=CYP PE=2 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 1.256e-72
Identity = 132/171 (77.19%), Postives = 140/171 (81.87%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NPKV+FDMTVG + AGRIVMEL+AD  P TAENFRALCTGE+GIGKSGKPLHYKGS+FHRVIP FMCQ            ESIYG KF DENFVKKHTGPGILSM NAG  TNGSQFF+CT KT WLDGKHVVFGQVVEGMDVV+ IEKVGS SGRT+K VV  DCGQL
Sbjct:    1 MVNPKVYFDMTVGDKAAGRIVMELYADTVPETAENFRALCTGERGIGKSGKPLHYKGSAFHRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFVKKHTGPGILSMRNAGSNTNGSQFFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTSKKVVTCDCGQL 171          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP18D_ARATH (Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana GN=CYP18-4 PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.143e-72
Identity = 129/172 (75.00%), Postives = 142/172 (82.56%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            M NP+VFFDM++ G P GRI MELFAD TP TAENFRALCTGEKG+GK GKPLH+KGS FHRVIPGFMCQ            ESIYG+KF DENF+KKHTG GILSMAN+GP TNGSQFF+CT KT WLDGKHVVFGQVV+G+DVVKAIEKVGS SG+T+K V I DCGQLS
Sbjct:    1 MSNPRVFFDMSLSGTPIGRIEMELFADTTPNTAENFRALCTGEKGMGKLGKPLHFKGSIFHRVIPGFMCQGGDFTAKNGTGGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFFICTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSGKTSKVVTITDCGQLS 172          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CYPH_MAIZE (Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN=CYP PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.814e-71
Identity = 128/172 (74.42%), Postives = 141/172 (81.98%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 560
            M NP+VFFDMTVGG PAGRIVMEL+A+  P+TAENFRALCTGEKG+GKSGKPLHYKGS+FHRVIP FMCQ            ESIYG KF DE FV+K   PG+LSMANAGP TNGSQFF+CT  T WLDGKHVVFGQVVEGMDVVKAIEKVG+ +G T+K V +ADCGQLS
Sbjct:    1 MANPRVFFDMTVGGAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKQPAPGVLSMANAGPNTNGSQFFICTVATPWLDGKHVVFGQVVEGMDVVKAIEKVGTRNGSTSKVVKVADCGQLS 172          
BLAST of DC900268 vs. ExPASy Swiss-Prot
Match: CP19C_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana GN=CYP19-3 PE=1 SV=2)

HSP 1 Score: 257.684 bits (657), Expect = 5.462e-68
Identity = 122/171 (71.35%), Postives = 137/171 (80.12%), Query Frame = 3
Query:   45 MPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 557
            M NPKVFFD+ +G   AGR+VMELFADVTPRTA NFRALCTGE GIGK+GK LHYKGS+FHR+IPGFMCQ            ESIYGSKF DENF  KHTGPGILSMAN+GP TNGSQFF+CT KT WLDGKHVVFG+VV+G +VVKA+E VGS  G  ++ VVI DCG+L
Sbjct:    1 MANPKVFFDILIGKMKAGRVVMELFADVTPRTANNFRALCTGENGIGKAGKALHYKGSAFHRIIPGFMCQGGDFTRGNGTGGESIYGSKFEDENFKLKHTGPGILSMANSGPNTNGSQFFICTEKTSWLDGKHVVFGKVVDGYNVVKAMEDVGSDMGNPSERVVIEDCGEL 171          
The following BLAST results are available for this feature:
BLAST of DC900268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 232
Match NameE-valueIdentityDescription
CYPH_CATRO3.896e-8284.88Peptidyl-prolyl cis-trans isomerase OS=Catharanthu... [more]
CYPH_SOLLC1.810e-7981.29Peptidyl-prolyl cis-trans isomerase OS=Solanum lyc... [more]
CYPH_LUPLU6.437e-7777.33Peptidyl-prolyl cis-trans isomerase OS=Lupinus lut... [more]
CP19A_ARATH7.117e-7679.41Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Ara... [more]
CP19B_ARATH4.613e-7576.47Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Ara... [more]
CP18C_ARATH6.025e-7577.33Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Ara... [more]
CYPH_BRANA1.256e-7277.19Peptidyl-prolyl cis-trans isomerase OS=Brassica na... [more]
CP18D_ARATH2.143e-7275.00Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Ara... [more]
CYPH_MAIZE1.814e-7174.42Peptidyl-prolyl cis-trans isomerase OS=Zea mays GN... [more]
CP19C_ARATH5.462e-6871.35Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900268 VSS Citrus sinensis cDNA clone VS28611 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900268 ID=DC900268|Name=DC900268|organism=Citrus sinensis|type=EST|length=798bp
TCCGTGTTTAGTTTGTTTTTTTCTCTCCAATCAACCAATCAAAAATGCCA
AACCCCAAAGTGTTCTTCGACATGACCGTCGGCGGTCAGCCCGCCGGCAG
GATCGTGATGGAGCTCTTCGCCGATGTCACCCCCCGAACCGCCGAGAACT
TCCGCGCCCTCTGCACCGGCGAGAAAGGCATCGGCAAGTCCGGCAAGCCA
CTCCACTACAAGGGCTCGTCCTTCCACCGTGTGATCCCCGGATTCATGTG
CCAGGGGGGAGACTTCACCGCCGGAAACGGAACCGGAGGCGAATCAATCT
ACGGCTCAAAATTCGCCGATGAGAACTTCGTGAAGAAGCACACCGGCCCC
GGAATCCTCTCCATGGCGAATGCCGGACCCGGAACCAACGGATCTCAGTT
CTTCGTCTGTACGGCCAAGACCGAGTGGCTCGATGGGAAGCACGTTGTGT
TCGGTCAAGTCGTCGAAGGAATGGACGTCGTCAAGGCCATCGAGAAAGTG
GGGTCCAGCTCCGGAAGGACCAACAAGCCCGTCGTGATCGCTGATTGCGG
TCAATTGTCTTAGATTTGATCATGATAATGATCGCCATCATCACGAGCCG
TCTGATCGCGATCGTGATGGTGATTATGTTATCTATTATTATGTGGCCGT
GTCTGTAGGACTTTTAATCTTTATCTAATTTTCCTGCTATGGTACTTGGT
CGGGTTGGATCGGGTCTCCGGTGGTGGTTCTTGATGAACTGGTTTTTATG
GCTTTCTATGAGCTGCCTTTTAAATAAAAAAGGGCTTGCTTGTTTTTT
back to top