DC900267

Overview
NameDC900267
Unique NameDC900267
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3495 contig Csv1_Contig3495:972..1533. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: SYM_ARATH (Probable methionyl-tRNA synthetase OS=Arabidopsis thaliana GN=At4g13780 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.725e-36
Identity = 72/93 (77.42%), Postives = 81/93 (87.10%), Query Frame = 3
Query:    6 IKSHAMVLCASTSDNTKVELVEPPKSAKIGERVAFPGFEGEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSAGICTVSSIQSGSIR 284
            I S AMVL AS+SD +KVELVEPPK+A IGERV FPGFEGEPDDVLNPKKKVWET+ VDL+T   LVACYKD+PFTTSAG+C VSSI +G+IR
Sbjct:  705 IVSQAMVLAASSSDGSKVELVEPPKTANIGERVTFPGFEGEPDDVLNPKKKVWETLLVDLNTKENLVACYKDVPFTTSAGVCKVSSISNGTIR 797          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: SYM_ORYSJ (Probable methionyl-tRNA synthetase OS=Oryza sativa subsp. japonica GN=Os06g0508700 PE=2 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 1.465e-32
Identity = 65/94 (69.15%), Postives = 74/94 (78.72%), Query Frame = 3
Query:    3 GIKSHAMVLCASTSDNTKVELVEPPKSAKIGERVAFPGFEGEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSAGICTVSSIQSGSIR 284
            GIKSHAMVL AS  D+TKVELVEPP+SA +GERV F G+ GEP+  LN K K WE +  DLH+N ELVACYKD+PFTTSAG+C V SI SG IR
Sbjct:  708 GIKSHAMVLAASNEDHTKVELVEPPESAAVGERVTFAGYSGEPEASLNAKSKTWEKLSADLHSNGELVACYKDVPFTTSAGVCKVKSIASGEIR 801          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: AIMP1_HUMAN (Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Homo sapiens GN=AIMP1 PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 8.337e-20
Identity = 44/95 (46.32%), Postives = 62/95 (65.26%), Query Frame = 3
Query:    3 GIKSHAMVLCASTSDNTKVELVEPPKSAKIGERVAFPGFEGEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSA-GICTVSSIQSGSIR 284
            G+ S AMV+CAS+ +  K+E++ PP  +  G+R+ F  F GEPD  LNPKKK+WE +Q DLHTN E VA YK +PF     G+C   ++ +  I+
Sbjct:  220 GVLSQAMVMCASSPE--KIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK 312          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: AIMP1_MOUSE (Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Mus musculus GN=Aimp1 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 1.857e-19
Identity = 45/95 (47.37%), Postives = 61/95 (64.21%), Query Frame = 3
Query:    3 GIKSHAMVLCASTSDNTKVELVEPPKSAKIGERVAFPGFEGEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSA-GICTVSSIQSGSIR 284
            G+ S AMV+CAS+ +  KVE++ PP  +  G+R+ F  F GEPD  LNPKKK+WE +Q DLHTN E VA YK  PF     G+C   ++ +  I+
Sbjct:  218 GVLSQAMVMCASSPE--KVEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAECVATYKGAPFEVKGKGVCRAQTMANSGIK 310          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: AIMP1_CRIGR (Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Cricetulus griseus GN=AIMP1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.857e-19
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 3
Query:    3 GIKSHAMVLCASTSDNTKVELVEPPKSAKIGERVAFPGFEGEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSA-GICTVSSIQSGSIR 284
            GI S AMV+CAS+ +  KVE++ PP  +  G+R+ F  F GEPD  LNPKKK+WE +Q DLHTN E VA YK  PF     G+C   ++ +  I+
Sbjct:  267 GILSQAMVMCASSPE--KVEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAECVATYKGSPFEVKGKGVCRAQTMANSGIK 359          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: SYYC_DANRE (Tyrosyl-tRNA synthetase, cytoplasmic OS=Danio rerio GN=yars PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 2.350e-14
Identity = 44/95 (46.32%), Postives = 62/95 (65.26%), Query Frame = 3
Query:    3 GIKSHAMVLCASTS-DNTKVELVEPPKSAKIGERVAFPGFE-GEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSAGICTVSSIQSGSI 281
            GI+S AMVLCAS   +  KVE ++PP+ +  G+RV   G+E G+PDD L PKKKV+E +QVDL  + E VA +K+    T  G  T  +++ G+I
Sbjct:  434 GIESQAMVLCASIEGEPRKVEPLDPPEGSAAGDRVYVEGYESGKPDDELKPKKKVFEKLQVDLKISGEFVAQWKEQNLMTKLGRITCKTLKGGNI 528          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: YLF4_SCHPO (Uncharacterized tRNA-binding protein C30C2.04 OS=Schizosaccharomyces pombe GN=SPAC30C2.04 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.234e-14
Identity = 38/101 (37.62%), Postives = 60/101 (59.41%), Query Frame = 3
Query:    6 IKSHAMVLCASTSDNTKVELVEPPKSAKIGERVAFPGFE-GEPDDVLNPKKKVWETVQVDLHTNTELVACYKD--------IPFTTSAGICTVSSIQSGSI 281
            +KS AMV CAS+ D + VE V PP++A+IG+R+ F GF+  EP+  LNPK+K+WE +Q    +  +L+  YKD        +      G C   ++ +G++
Sbjct:  349 VKSQAMVFCASSPDKSVVEFVLPPENAEIGDRLTFEGFDTEEPEAQLNPKRKIWEAIQPGFTSGEDLICGYKDESGLHRLFVKGKKDLGFCKAQTVVNGTL 449          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: SYYC_BOVIN (Tyrosyl-tRNA synthetase, cytoplasmic OS=Bos taurus GN=YARS PE=2 SV=4)

HSP 1 Score: 76.6406 bits (187), Expect = 8.928e-14
Identity = 41/95 (43.16%), Postives = 58/95 (61.05%), Query Frame = 3
Query:    3 GIKSHAMVLCASTSD-NTKVELVEPPKSAKIGERVAFPGFE-GEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSAGICTVSSIQSGSI 281
            G+KS  M+LCAS    N KVE ++PP  +  GERV   G+E G+PD+ L PKKKV+E +Q D   + E +A +K   F T  G  +  S++ G+I
Sbjct:  433 GVKSQGMLLCASVEGVNRKVEPLDPPAGSAPGERVFVKGYEKGQPDEELKPKKKVFEKLQADFKISDEYIAQWKQTNFMTKMGSVSCKSLKGGNI 527          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: SYYC_CHICK (Tyrosyl-tRNA synthetase, cytoplasmic OS=Gallus gallus GN=YARS PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.523e-13
Identity = 41/95 (43.16%), Postives = 59/95 (62.11%), Query Frame = 3
Query:    3 GIKSHAMVLCAST-SDNTKVELVEPPKSAKIGERVAFPGFE-GEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSAGICTVSSIQSGSI 281
            G++S  MVLCAS+  +  +VE ++PP     GERV   G+E GEPDD L PKKKV+E +Q D   + + +A +K+  F T  G  +  S++ GSI
Sbjct:  432 GVESQGMVLCASSVGEPRQVEPLDPPAECCAGERVYVEGYEDGEPDDELKPKKKVFEKLQADFRISEDCIAQWKERNFLTKLGSISCKSLKGGSI 526          
BLAST of DC900267 vs. ExPASy Swiss-Prot
Match: SYYC_XENLA (Tyrosyl-tRNA synthetase, cytoplasmic OS=Xenopus laevis GN=yars PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.989e-13
Identity = 42/95 (44.21%), Postives = 58/95 (61.05%), Query Frame = 3
Query:    3 GIKSHAMVLCASTSDNTK-VELVEPPKSAKIGERVAFPGFE-GEPDDVLNPKKKVWETVQVDLHTNTELVACYKDIPFTTSAGICTVSSIQSGSI 281
            GI+S  M+LCAST    K VE ++PP  +  GER+   G+E GEP+  L PKKKV+E +QVD   + +L A +K   F T  G  T  +++ GSI
Sbjct:  433 GIESQGMLLCASTEGEQKQVEPLDPPSGSAPGERIYIEGYENGEPEGELKPKKKVFEKLQVDFRISDDLCAQWKGKNFLTKLGSVTCKTLRGGSI 527          
The following BLAST results are available for this feature:
BLAST of DC900267 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
SYM_ARATH3.725e-3677.42Probable methionyl-tRNA synthetase OS=Arabidopsis ... [more]
SYM_ORYSJ1.465e-3269.15Probable methionyl-tRNA synthetase OS=Oryza sativa... [more]
AIMP1_HUMAN8.337e-2046.32Aminoacyl tRNA synthetase complex-interacting mult... [more]
AIMP1_MOUSE1.857e-1947.37Aminoacyl tRNA synthetase complex-interacting mult... [more]
AIMP1_CRIGR1.857e-1948.42Aminoacyl tRNA synthetase complex-interacting mult... [more]
SYYC_DANRE2.350e-1446.32Tyrosyl-tRNA synthetase, cytoplasmic OS=Danio reri... [more]
YLF4_SCHPO5.234e-1437.62Uncharacterized tRNA-binding protein C30C2.04 OS=S... [more]
SYYC_BOVIN8.928e-1443.16Tyrosyl-tRNA synthetase, cytoplasmic OS=Bos taurus... [more]
SYYC_CHICK1.523e-1343.16Tyrosyl-tRNA synthetase, cytoplasmic OS=Gallus gal... [more]
SYYC_XENLA1.989e-1344.21Tyrosyl-tRNA synthetase, cytoplasmic OS=Xenopus la... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900267 VSS Citrus sinensis cDNA clone VS28610 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900267 ID=DC900267|Name=DC900267|organism=Citrus sinensis|type=EST|length=562bp
GGGGAATCAAATCACATGCAATGGTTCTTTGTGCTTCAACCAGTGATAAC
ACCAAGGTTGAATTGGTTGAGCCACCAAAATCTGCAAAAATTGGAGAAAG
AGTTGCATTTCCTGGGTTTGAAGGCGAGCCTGATGATGTGTTAAACCCTA
AGAAGAAGGTTTGGGAGACAGTGCAAGTGGATTTACACACTAACACCGAG
CTGGTGGCCTGCTATAAAGATATTCCTTTCACGACATCAGCTGGTATTTG
CACTGTTTCCTCCATTCAAAGTGGGTCTATACGGTAGCTCGACTTCTTCA
ATCATTGGAAAGCGAGAATTCCTAATCTTCTGATTGTGTTAACTTTGCTT
TTTTATCCTAGTGACTTTTTCTCGTTGTGTGAAATGTTGTATGTGGACAA
GAATTTTGTGTCAGTAGTAGACTAGATTATGTCGTGGCTTCATTAGTGTT
ACCTTTTCCCCTCATTAGAAGAAAACCCAATTGCCTTGAGCAATGAGCAG
TTTGAATTCACGATCTTATATACAAGGATTTATGTCAAGGGTTTGAACCC
AAGCTTCAGATT
back to top