DC900264

Overview
NameDC900264
Unique NameDC900264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length555
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900264_ssr4 microsatellite DC900264_ssr4:4..55. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900264 vs. ExPASy Swiss-Prot
Match: YB95_ARATH (Uncharacterized protein At2g39795, mitochondrial OS=Arabidopsis thaliana GN=At2g39795 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.064e-35
Identity = 79/147 (53.74%), Postives = 104/147 (70.75%), Query Frame = 1
Query:   76 SILLSREYGDEIIKVEVDMPNPVFFLEEEGFGNEDEGADNRTSIPLVVSISKKXGXCLEFGVTAFSDEISIDSLSVKQP-EASDDQLAYEGPXFGDLDENLQKAFPKYLEIRGIKASPXNFLXEYMXXKASXEXLGWLKNLXKFIEK 513
            ++ L+R+Y  E IKV V MP+ V   E +   ++DEG  N +SIPLVV+++KK G  LEF   AF DEI+ID+LSVK P ++ +DQLA EGP F DLDENL+K F K+LEIRG+KAS  NFL EYM  K + E   WLKN+ +F+E+
Sbjct:  105 NVTLTRDYNGEHIKVVVSMPSLVSD-ENDDDDDDDEGPSNESSIPLVVTVTKKSGLTLEFSCMAFPDEIAIDALSVKHPGDSLEDQLANEGPDFEDLDENLKKTFYKFLEIRGVKASTTNFLHEYMTRKVNREYFLWLKNVKEFMEQ 250          
BLAST of DC900264 vs. ExPASy Swiss-Prot
Match: Y2979_ARATH (Uncharacterized protein At2g39790, mitochondrial OS=Arabidopsis thaliana GN=At2g39790 PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 1.775e-14
Identity = 56/149 (37.58%), Postives = 82/149 (55.03%), Query Frame = 1
Query:   76 SILLSREYGDEIIKVEVDMPNPVFFLEEEG---FG-NEDEGADNRTSIPLVVSISKKXGXCLEFGVTAFSDEISIDSLSVKQPEASDDQLAYEGPXFGDLDENLQKAFPKYLEIRGIKASPXNFLXEYMXXKASXEXLGWLKNLXKFIE 510
            S+ L+  Y DE I V+V MP    +L ++    FG N DE      S PLVV++ KK G  +EF   A++D I +  L+V   +    +   + P F +LD+NL+KAF +YL  R + A+    L +YM  K   E L WLKN+ KF++
Sbjct:  103 SVTLTAYYNDERIHVDVGMP----YLGDDVIDVFGPNNDE-----LSFPLVVTVIKKNGVSIEFTCQAYADYIDLTDLTVHDYQYQMGET--DWPRFKNLDDNLKKAFHRYLATR-LDANITKLLHKYMVSKIKREYLLWLKNVNKFVD 239          
The following BLAST results are available for this feature:
BLAST of DC900264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
YB95_ARATH4.064e-3553.74Uncharacterized protein At2g39795, mitochondrial O... [more]
Y2979_ARATH1.775e-1437.58Uncharacterized protein At2g39790, mitochondrial O... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900264 VSS Citrus sinensis cDNA clone VS28608 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900264 ID=DC900264|Name=DC900264|organism=Citrus sinensis|type=EST|length=555bp
AGTAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGA
GAGAGCTCGTGCCGAATTCGGCACGAGCATATTACTATCAAGAGAGTACG
GGGATGAAATTATCAAAGTGGAAGTTGACATGCCTAATCCTGTTTTTTTT
TTGGAAGAAGAAGGTTTTGGCAATGAAGACGAGGGGGCTGATAACCGTAC
TAGCATTCCTTTGGTTGTGAGTATATCGAAAAAGNACGGTNCGTGCCTGG
AATTTGGTGTAACTGCTTTTTCGGATGAAATTTCAATTGATAGCTTGTCA
GTGAAGCAGCCCGAAGCTTCTGATGATCAGCTTGCATATGAAGGGCCTGN
CTTTGGTGATTTGGATGAAAACTTGCAAAAAGCTTTCCCCAAATATCTGG
AGATAAGAGGTATCAAAGCCAGCCCANCAAACTTCTTGCNGGAGTACATG
ATNANCAAAGCCAGCNAAGAGTNCTTGGGTTGGTTGAAGAACCTCNAGAA
ATTTATTGAAAAGTGAATTCATTNTGAACCCNTGACTCTTTTGTGAGTGG
GGATA
back to top