DC900257

Overview
NameDC900257
Unique NameDC900257
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length735
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2656 contig Csv1_Contig2656:19..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_BOVIN (Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.695e-38
Identity = 80/157 (50.96%), Postives = 104/157 (66.24%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDP---VQKLASCGCDNTVKVWKMY-NGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVV 454
            H +G  +VSWAPA+ PG+L+          ++K AS GCDN +K+WK   +G WK +    L+ HSDWVR VAWAP++GLP STIAS SQDG V +WTC    G  W  ++L  F   VW VSWS+T N+LAV+  +N VTLWKE+VDG+W  +S V
Sbjct:  149 HTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWKEEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFVWTCDDASGNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDV 303          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_RAT (Protein SEC13 homolog OS=Rattus norvegicus GN=Sec13 PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 8.744e-38
Identity = 80/157 (50.96%), Postives = 104/157 (66.24%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDP---VQKLASCGCDNTVKVWKMY-NGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVV 454
            H +G  +VSWAPA+ PG+L+          ++K AS GCDN +K+W+   +G WK +    L+ HSDWVR VAWAP++GLP STIAS SQDG V IWTC    G  W  ++L  F   VW VSWS+T N+LAV+  +N VTLWKE+VDG+W  +S V
Sbjct:  149 HTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWREEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDV 303          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_MOUSE (Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=2 SV=3)

HSP 1 Score: 157.147 bits (396), Expect = 8.744e-38
Identity = 80/157 (50.96%), Postives = 104/157 (66.24%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDP---VQKLASCGCDNTVKVWKMY-NGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVV 454
            H +G  +VSWAPA+ PG+L+          ++K AS GCDN +K+W+   +G WK +    L+ HSDWVR VAWAP++GLP STIAS SQDG V IWTC    G  W  ++L  F   VW VSWS+T N+LAV+  +N VTLWKE+VDG+W  +S V
Sbjct:  149 HTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASGGCDNLIKLWREEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDV 303          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_HUMAN (Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=1 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 7.402e-37
Identity = 79/157 (50.32%), Postives = 103/157 (65.61%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDP---VQKLASCGCDNTVKVWKMY-NGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVV 454
            H +G  +VSWAPA+ PG+L+          +++ AS GCDN +K+WK   +G WK +    L+ HSDWVR VAWAP++GLP STIAS SQDG V IWTC       W  ++L  F   VW VSWS+T N+LAV+  +N VTLWKE+VDG+W  +S V
Sbjct:  149 HTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDV 303          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_DICDI (Protein transport protein SEC13 OS=Dictyostelium discoideum GN=sec13 PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.633e-34
Identity = 74/154 (48.05%), Postives = 100/154 (64.94%), Query Frame = 2
Query:    8 VGVTSVSWAPAMAPGALVGLG---LLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            +GV SVSW+PA  P +LV      +  P++++ +  CDN +K++K     W +D    L+ H DWVR VAWAPN+GLP S IAS SQD +V++WT  + G  W G+ L  F   VW VSWS+ GN+LAV+  +N VTLWKE VD EW+ +S VE
Sbjct:  149 IGVNSVSWSPAAIPTSLVNSANTIIPAPIKRIVTGSCDNLIKIFKNVEDKWILD--KQLEDHKDWVRDVAWAPNIGLPYSKIASCSQDRSVIVWTQDENG-VWSGKPLPKFDDIVWRVSWSVIGNILAVSCGDNQVTLWKEGVDSEWKLISHVE 299          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_USTMA (Protein transport protein SEC13 OS=Ustilago maydis GN=SEC13 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.490e-32
Identity = 76/178 (42.70%), Postives = 101/178 (56.74%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGL------------GLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVL-------------KDFKTPVWSVSWSLTGNLLAVADAN-NVTLWKEAVDGEWQQVSVVE 457
            HPVG  +VSWAPA+ PG+L+              G    V++ AS GCDNTVK+W+      +     ALQ HSDWVR VA+APN+GLP+S +A+ASQD TV+IWT       W    L               F   VW VSWS++GN+LAV+  +  +TLWKE + G W+ VS ++
Sbjct:  186 HPVGCNAVSWAPAVVPGSLISAQSVGANAGAASNGEAKLVKRFASAGCDNTVKIWEFSQEANRFVEVEALQGHSDWVRDVAFAPNVGLPRSYLATASQDRTVLIWTQDSPTAAWSKTALNPISASAAAGAGSNKFPDTVWRVSWSVSGNVLAVSCGDGKITLWKENLKGAWECVSEMD 363          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_MAGGR (Protein transport protein SEC13 OS=Magnaporthe grisea GN=SEC13 PE=3 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 3.934e-30
Identity = 74/157 (47.13%), Postives = 95/157 (60.51%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGLGLLDPVQK-LASCGCDNTVKVWKMYNGIWKMDCFPA--LQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQ-WEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H  GV SVSWAP+ APG+++        Q+   + G DNT+K+W       +  C     L  H+DWV  V W+P + L KS IASASQD TV IWT        W+ RVLK+F T VW VSWSL+GN+LAV+  +N VTLWKE + GEW  V+ +E
Sbjct:  140 HGQGVNSVSWAPSTAPGSIISTNATPAAQRRFVTGGSDNTLKIWSWDAASAQYRCEEGGVLSGHTDWVLDVDWSPTV-LQKSYIASASQDRTVRIWTSDSSNPGVWQSRVLKEFDTTVWRVSWSLSGNVLAVSSGDNKVTLWKENLKGEWACVNSLE 295          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_YARLI (Protein transport protein SEC13 OS=Yarrowia lipolytica GN=SEC13 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.550e-29
Identity = 74/158 (46.84%), Postives = 96/158 (60.76%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALVGL--GLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTCAKEGEQ-WEGRVLKDFKTP--VWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H VG  S SWAP    G+L+    G      ++ + GCDN VK+WK             L  H DWVR VAW+ ++ L KS IASASQD TV++WT  +EG Q W+ ++L+D   P  VW VSWSL+GN+LAV+  +N VTLWKE + GEW+   VVE
Sbjct:  143 HDVGANSASWAPPAVSGSLIQPINGKASNNIRIVTGGCDNLVKIWKYDPSSKTYVIEETLSGHKDWVRDVAWSSSV-LSKSYIASASQDKTVIVWT--QEGNQPWKKKLLQDIPFPDVVWKVSWSLSGNVLAVSGGDNKVTLWKENLTGEWESAGVVE 297          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_EMENI (Protein transport protein sec13 OS=Emericella nidulans GN=sec13 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.690e-29
Identity = 71/158 (44.94%), Postives = 100/158 (63.29%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALV----GLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWTC-AKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV S+SWAPA +PG+LV    G+G     ++  + G DN +K+W         +    L+ HSDWVR VAW+P++ L KS IASASQD TV +WT  A    QW  +VL +F   +W VSWS +GN+LAV+  +N V+LWKE + G+W++V  +E
Sbjct:  156 HGMGVNSISWAPAASPGSLVSSNPGIG---QQRRFVTGGSDNLLKIWDYNPETKTYNATQTLEGHSDWVRDVAWSPSI-LSKSYIASASQDKTVRVWTADASNPGQWTSQVL-EFDNVLWRVSWSPSGNILAVSGGDNKVSLWKENLRGQWEKVKDIE 308          
BLAST of DC900257 vs. ExPASy Swiss-Prot
Match: SEC13_NEUCR (Protein transport protein sec-13 OS=Neurospora crassa GN=sec-13 PE=3 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.266e-28
Identity = 80/162 (49.38%), Postives = 103/162 (63.58%), Query Frame = 2
Query:    2 HPVGVTSVSWAPAMAPGALV----GLGLLDPVQKLASCGCDNTVKVWKM---YNGIWKMDCFPALQMHSDWVRSVAWAPNLGLPKSTIASASQDGTVVIWT--CAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADANN-VTLWKEAVDGEWQQVSVVE 457
            H +GV SVSWAPA  PG++V    G G     ++  + G DN +K+W      NG +K++  P L  H+DWVR VAW+P + L KS IASASQD TV IWT   A  GE W+ +VL +F   VW VSWSL+GN+LA +  NN VTLWKE + GEW+ V  +E
Sbjct:  148 HGLGVNSVSWAPATTPGSIVSSNPGPGSTGN-RRFVTGGSDNLLKIWTFDPATNG-YKLEREP-LAGHTDWVRDVAWSPTV-LQKSYIASASQDKTVRIWTSDAANPGE-WKCKVL-NFDAAVWRVSWSLSGNVLAASSDNNKVTLWKENLKGEWENVKTIE 303          
The following BLAST results are available for this feature:
BLAST of DC900257 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
SEC13_BOVIN6.695e-3850.96Protein SEC13 homolog OS=Bos taurus GN=SEC13 PE=2 ... [more]
SEC13_RAT8.744e-3850.96Protein SEC13 homolog OS=Rattus norvegicus GN=Sec1... [more]
SEC13_MOUSE8.744e-3850.96Protein SEC13 homolog OS=Mus musculus GN=Sec13 PE=... [more]
SEC13_HUMAN7.402e-3750.32Protein SEC13 homolog OS=Homo sapiens GN=SEC13 PE=... [more]
SEC13_DICDI2.633e-3448.05Protein transport protein SEC13 OS=Dictyostelium d... [more]
SEC13_USTMA5.490e-3242.70Protein transport protein SEC13 OS=Ustilago maydis... [more]
SEC13_MAGGR3.934e-3047.13Protein transport protein SEC13 OS=Magnaporthe gri... [more]
SEC13_YARLI2.550e-2946.84Protein transport protein SEC13 OS=Yarrowia lipoly... [more]
SEC13_EMENI9.690e-2944.94Protein transport protein sec13 OS=Emericella nidu... [more]
SEC13_NEUCR1.266e-2849.38Protein transport protein sec-13 OS=Neurospora cra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900257 VSS Citrus sinensis cDNA clone VS28601 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900257 ID=DC900257|Name=DC900257|organism=Citrus sinensis|type=EST|length=735bp
CCATCCAGTCGGAGTAACATCTGTTTCATGGGCCCCGGCAATGGCTCCTG
GTGCTTTAGTTGGATTGGGCTTACTGGATCCTGTTCAGAAATTGGCTTCT
TGTGGTTGTGATAATACTGTAAAGGTGTGGAAGATGTATAATGGGATTTG
GAAGATGGATTGCTTCCCTGCCCTTCAGATGCACAGTGATTGGGTGCGGA
GCGTGGCGTGGGCTCCCAACTTGGGTCTTCCAAAATCCACAATTGCAAGT
GCATCACAGGATGGGACAGTTGTTATTTGGACCTGTGCCAAGGAAGGGGA
GCAATGGGAGGGTCGAGTTTTGAAGGATTTTAAGACACCAGTTTGGAGTG
TTTCGTGGTCACTGACTGGAAATTTGTTGGCTGTGGCTGATGCAAATAAT
GTGACATTGTGGAAGGAAGCTGTTGATGGTGAGTGGCAACAAGTGAGTGT
AGTTGAGCCACAGACATAAGGTGTCTTCCTACTTACCCTTTCACAATCAT
TGTGTTCTTTTTTGGACTTATTGGAAGTAGCCTTTCTTACACCTGGTTTA
GTTTTTTTTTTTTCCTTTTTTTTTGGTTGGATTGATTTTGTTGGAATACT
TAATTTGTATTTGGTTAGTTGTTATTCTTTCTTGCCAGATTCAGAAACAA
ATGATGGTGTCTTAATCTCCATATCCATATGTCTGTATTTGTGACTGCCA
ATATTTCTGTTAAATTACATATGAACTCTTTATCC
back to top