DC900254

Overview
NameDC900254
Unique NameDC900254
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length642
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900254_ssr486 microsatellite DC900254_ssr486:486..497. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1669 contig Csv1_Contig1669:758..1399. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_RAT (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Rattus norvegicus GN=Bckdhb PE=1 SV=3)

HSP 1 Score: 171.785 bits (434), Expect = 2.714e-42
Identity = 79/128 (61.72%), Postives = 103/128 (80.47%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIM-EQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY 381
            VI+EGSD+TLV WG Q+ ++ E A +  EK G+SCE+IDL+T++PWD +TV  SV KTGRLLISHEAP+TGGF +EIS+++ E CFL LEAP++RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct:  263 VIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIVPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY 390          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_MOUSE (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Mus musculus GN=Bckdhb PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 2.714e-42
Identity = 79/128 (61.72%), Postives = 103/128 (80.47%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIM-EQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY 381
            VI+EGSD+TLV WG Q+ ++ E A +  EK G+SCE+IDL+T++PWD +TV  SV KTGRLLISHEAP+TGGF +EIS+++ E CFL LEAP++RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct:  263 VIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIVPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY 390          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_HUMAN (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Homo sapiens GN=BCKDHB PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 2.714e-42
Identity = 79/128 (61.72%), Postives = 103/128 (80.47%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIM-EQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY 381
            VI+EGSD+TLV WG Q+ ++ E A +  EK G+SCE+IDL+T+IPWD +T+  SV KTGRLLISHEAP+TGGF +EIS+++ E CFL LEAP++RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct:  265 VIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY 392          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_BOVIN (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Bos taurus GN=BCKDHB PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 3.545e-42
Identity = 78/128 (60.94%), Postives = 103/128 (80.47%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIM-EQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY 381
            VI+EGSD+TLV WG Q+ ++ E A +  EK G+SCE+IDL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CFL LEAP++RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct:  265 VIQEGSDVTLVAWGTQVHVIREVAAMAQEKLGVSCEVIDLRTILPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY 392          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_DICDI (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Dictyostelium discoideum GN=bkdB PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.347e-41
Identity = 80/128 (62.50%), Postives = 102/128 (79.69%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQAC-LDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY 381
            +++EG DIT++GWGAQ+ ++ QA  +  EK GISCELIDL+T+ PWD ETV  SV+KTGR++ISHEAP TGG+ AEISA+I ERCFL LEAP+ RVCG DTPFPL+FE FY+P   K  ++IK T+ Y
Sbjct:  243 IVKEGKDITIIGWGAQMRVLLQAVNMAEEKLGISCELIDLRTIQPWDVETVVESVKKTGRVVISHEAPKTGGWAAEISATIQERCFLHLEAPIQRVCGYDTPFPLIFEKFYVPDHLKNFESIKKTMVY 370          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_THET8 (2-oxoisovalerate dehydrogenase subunit beta OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0230 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.426e-24
Identity = 54/125 (43.20%), Postives = 80/125 (64.00%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY 381
            REG D+TL+G+G  +  + QA  +  K G+S E++DL+TL+PWD E V  SV KTGR+++  +AP    F +E++A+I E     L AP  RV G DTP+P   +  Y+PT  +IL+A K  ++Y
Sbjct:  200 REGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYPYAQDKLYLPTVTRILNAAKRALDY 324          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODBB_THET2 (2-oxoisovalerate dehydrogenase subunit beta OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C1756 PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.426e-24
Identity = 54/125 (43.20%), Postives = 80/125 (64.00%), Query Frame = 1
Query:    7 REGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY 381
            REG D+TL+G+G  +  + QA  +  K G+S E++DL+TL+PWD E V  SV KTGR+++  +AP    F +E++A+I E     L AP  RV G DTP+P   +  Y+PT  +IL+A K  ++Y
Sbjct:  200 REGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLMPWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYPYAQDKLYLPTVTRILNAAKRALDY 324          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAES (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdhB PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.078e-22
Identity = 54/128 (42.19%), Postives = 82/128 (64.06%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DITL+ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA+++A + ER  L LEAP+ARV   DT +P    E  ++P K  I++  K+T+ +
Sbjct:  198 VKKEGNDITLISYGAMVQESLKAAEELEKDGYSVEVIDLRTVQPIDIDTLVASVEKTGRAVVVQEAQRQAGVGAQVAAELAERAILSLEAPIARVAASDTIYPFTQAENVWLPNKKDIIEQAKATLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_STAEQ (Pyruvate dehydrogenase E1 component subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdhB PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.078e-22
Identity = 54/128 (42.19%), Postives = 82/128 (64.06%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLV-FEPFYMPTKNKILDAIKSTVNY 381
            V +EG+DITL+ +GA +    +A  + EK+G S E+IDL+T+ P D +T+ ASV KTGR ++  EA    G GA+++A + ER  L LEAP+ARV   DT +P    E  ++P K  I++  K+T+ +
Sbjct:  198 VKKEGNDITLISYGAMVQESLKAAEELEKDGYSVEVIDLRTVQPIDIDTLVASVEKTGRAVVVQEAQRQAGVGAQVAAELAERAILSLEAPIARVAASDTIYPFTQAENVWLPNKKDIIEQAKATLEF 325          
BLAST of DC900254 vs. ExPASy Swiss-Prot
Match: ODPB_LEIXX (Pyruvate dehydrogenase E1 component subunit beta OS=Leifsonia xyli subsp. xyli GN=pdhB PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.078e-22
Identity = 52/128 (40.62%), Postives = 80/128 (62.50%), Query Frame = 1
Query:    1 VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPF-PLVFEPFYMPTKNKILDAIKSTVNY 381
            ++R G+D T+V W   + +  +A   A +EG S E++DL++L P D   V  SV+KTGRL+++ EAP     G+E++A + E+ F  LEAPV RV G DTPF P   E  Y+P  ++IL+ +  ++ Y
Sbjct:  210 IVRSGTDATIVAWAGMVPVALRAAEIAAEEGRSLEVVDLRSLAPIDYAPVLRSVQKTGRLVVAQEAPGIVSVGSEVAAVVGEKAFYSLEAPVLRVAGFDTPFPPAKLESLYLPDADRILEVVDRSLAY 337          
The following BLAST results are available for this feature:
BLAST of DC900254 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
ODBB_RAT2.714e-4261.722-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_MOUSE2.714e-4261.722-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_HUMAN2.714e-4261.722-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_BOVIN3.545e-4260.942-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_DICDI1.347e-4162.502-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_THET87.426e-2443.202-oxoisovalerate dehydrogenase subunit beta OS=The... [more]
ODBB_THET27.426e-2443.202-oxoisovalerate dehydrogenase subunit beta OS=The... [more]
ODPB_STAES9.078e-2242.19Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_STAEQ9.078e-2242.19Pyruvate dehydrogenase E1 component subunit beta O... [more]
ODPB_LEIXX9.078e-2240.63Pyruvate dehydrogenase E1 component subunit beta O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900254 VSS Citrus sinensis cDNA clone VS28295 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900254 ID=DC900254|Name=DC900254|organism=Citrus sinensis|type=EST|length=642bp
GTGATTCGAGAAGGCAGTGACATAACACTTGTTGGCTGGGGAGCACAACT
CTCTATCATGGAGCAGGCCTGTTTAGATGCTGAAAAGGAAGGAATTTCTT
GTGAACTGATAGACCTGAAGACACTAATACCATGGGATAAGGAAACAGTA
GAGGCCTCTGTCAGGAAAACCGGACGACTTCTTATTAGCCACGAAGCTCC
GGTTACTGGAGGTTTTGGTGCTGAAATTTCTGCATCTATCCTTGAACGTT
GTTTCTTAAGATTAGAAGCTCCAGTGGCTCGAGTTTGTGGTCTGGACACT
CCCTTCCCTCTCGTTTTCGAACCATTCTACATGCCCACCAAGAATAAGAT
ATTAGATGCAATCAAATCAACTGTAAATTACTAAGAGGGTAACCATCTCT
ACTGCACAACTGCGGATACACAGGTCCAGAGATGAGTGAAATCCCTGCAA
TAGTTTTGCAGGAGGGGAGGTACCAATGTTCCAATACAAACAAACAATAA
GAAAGTTGTATACTCTCCGGAGTTGCTAATTGTTTGTAAACTGGTGGTAA
TGTTATTGGACTGAGCATGCTCACTTACATTCTGCATGTTTGATATGACA
AGTGCAAATGCCATTCTCATCAATGAAGTCCACTCTTTGTTT
back to top