CX043521

Overview
NameCX043521
Unique NameCX043521
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length722
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10852 contig Csv1_Contig10852:98..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043521 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.733e-28
Identity = 67/172 (38.95%), Postives = 99/172 (57.56%), Query Frame = -3
Query:  211 PLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXRNELCPLDVVQLSSDSERGTRLRFSMHD-KTSIINEDVDLNVRFST--ETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVG--VSNDHARRLALTN 711
            P++D  G++++    YY++S+I               + CP  VVQ  SD + GT + FS  D K  ++    D+N+ F    +  C+  TVWR+D+YD S GKW++TT GV+G PG  TL +WFK E+ G     YK   CPSVC+SC +LC+D+G    +D   RLAL++
Sbjct:   30 PVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAG--VLGYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSD 199          
BLAST of CX043521 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 116.316 bits (290), Expect = 1.658e-25
Identity = 64/175 (36.57%), Postives = 92/175 (52.57%), Query Frame = -3
Query:  211 DPLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXRNE--LCPLDVVQLSSDSERGTRLRFSMHD-KTSIINEDVDLNVRFSTETRCN--EPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVGVSNDH--ARRLALTN 714
            +P++D+ G K+    +YY+V  +              N   +CP  VVQ   + +    L F   + K  ++    DLN+ FS    C     TVWR+D YD S G++F+T GGV+GNPG +T+ +WFK E        YK+V CP+VC SC   C DVG+  D    RRLAL++
Sbjct:   34 NPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEF-CGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
BLAST of CX043521 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.662e-17
Identity = 60/170 (35.29%), Postives = 85/170 (50.00%), Query Frame = -3
Query:  211 PLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXRNEL-CPLDVVQLSSDSERGTRLRFSMHDKTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVGVSND--HARRLALTN 711
            P+VD+ G  V    DY++VSAI              N+  CPL VVQ   D+          + K +I+ E VDLNV+F+    CNE T W+VD + P    W +T GG +G  G ++  + FK ++ G   + YK   CPS   + +  CN+V +  D    RRL LTN
Sbjct:    5 PIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFDNGEPIIFSAIKNVKDNIVFESVDLNVKFNITINCNETTAWKVDRF-PGVIGWTVTLGGEKGYHGFESTHSMFKIKKAGLPFS-YKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTN 172          
BLAST of CX043521 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.933e-14
Identity = 48/168 (28.57%), Postives = 83/168 (49.40%), Query Frame = -3
Query:  217 ADPLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXRNELCPLDVVQLSSDSERGTRLRFSMHDKT-SIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVGVSNDHARRLAL 717
            A+ + D+ G  V    +YY+VSAI             R  +CP+ ++Q  SD + G  +RFS  +++   I  D +L + F  +  C E + W +       G+  +  GG E +P  + ++ +FK E++G     YK+V CP   +S    C+D+G++ +  R L L
Sbjct:    3 AEKVYDIEGYPVFLGSEYYIVSAIIGAGGGGVRPGRTRGSMCPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEFVEKPDCAESSKWVIVK---DSGEARVAIGGSEDHPQGELVRGFFKIEKLG--SLAYKLVFCP---KSSSGSCSDIGINYEGRRSLVL 162          
BLAST of CX043521 vs. ExPASy Swiss-Prot
Match: SPI2_SOLTU (Serine protease inhibitor 2 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.964e-11
Identity = 55/185 (29.73%), Postives = 84/185 (45.41%), Query Frame = -3
Query:  190 ADPLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXRNELCPL--DVVQLSSD-SERGTRLRF---SMHDKTSIINEDVDLNVRF--STETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVGVSNDHA-RRLALTNGRALAVV 717
            A P++DV G ++++   Y ++S                N   P    + + +SD    GT +RF   S H    I   ++ LN++F  ST   C   T+W+V  YD S G   + TGG  G    Q   +WFK   +   +  Y +++CP    S    C+ VGV + +  RRLAL N   L V+
Sbjct:    5 ATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENEL-LNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIG----QADSSWFKI--VKSSQLGYNLLYCPVTSSSDDQFCSKVGVVHQNGKRRLALVNENPLDVL 182          
The following BLAST results are available for this feature:
BLAST of CX043521 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
ASP_THECC2.733e-2838.9521 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU1.658e-2536.57Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA1.662e-1735.29Latex serine proteinase inhibitor OS=Carica papaya... [more]
DRTI_DELRE2.933e-1428.57Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
SPI2_SOLTU3.964e-1129.73Serine protease inhibitor 2 OS=Solanum tuberosum P... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_11F04_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-11F04-K7-1-7.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043521 ID=CX043521; Name=CX043521; organism=Citrus sinensis; type=EST; length=722bp
TTTTTTTTTTTTTTTTTAAACAGTCAAAATTCGCCACTTTATTTCGTTCA
AAGGTACACAGGCTAGCTAGCAATGACATTTTTGTTTATGTTATAAGCGT
CAAGGAGCTAGCCCGATCCATTATTTAGAGTAATGATACAAGGGCATTCA
AGACGCACATGAGGCTGATCTCTCGTTACCAGGGACTAGAACAACAGCAA
GCGCGCGCCCATTAGTGAGAGCCAAACGTCGAGCATGATCGTTAGAAACC
CCAACATCATTGCATAAAGATACACAGGATTCGCAAACGGAAGGACAGTG
AACAATCTTGTACATAGCTCGATCTCTTCCAATTCTCTCAAACTTAAACC
AGTTTTTCAAAGTTTGAGCTCCAGGGTTTCCTTCAACACCACCAGTTGTT
ATAAACCATTTTCCTCTCGATGGATCATAGCTGTCGACTCTCCATACTGT
TGGTTCGTTGCAGCGAGTCTCTGTGGAGAATCTCACGTTCAGATCCACAT
CTTCATTGATAATACTAGTTTTATCATGCATTGAGAATCTTAAACGGGTT
CCTCTTTCTGAGTCGGAACTTAGTTGGACAACATCAAGTGGGCAGAGTTC
GTTTCTGCCCCTGAAGAGGGTGAGGCCGCCACCGCCTGCTCCTCGAATTG
CTGAGACCAAATAGTAGTCTCGGGATGCTTCGACCTTGTTGCCATGGACA
TCAACCAAAGGATCAGCGAGTC
back to top