DC900244

Overview
NameDC900244
Unique NameDC900244
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1002
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: TPT2_BRAOB (Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 3.093e-97
Identity = 149/183 (81.42%), Postives = 169/183 (92.35%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGEFPTLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEVYVRSLIAAICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            HTLGNLFTNMSLGKV+VSFTHTIKA EPFFSV+LSAMFLGE PT WV+GS+IPI+GGVALASVTEVSFNWAGF SAMASNLTNQSRNVLSKKVMV K+++LDNITLFSIIT+MS  LM PVT   EG+ FTP+Y+QSAG+N++++Y +SLIAA+C+HAYQQVSYMIL RVSPVTHSVGNCVKR
Sbjct:  174 HTLGNLFTNMSLGKVSVSFTHTIKAMEPFFSVVLSAMFLGEVPTPWVIGSIIPIVGGVALASVTEVSFNWAGFLSAMASNLTNQSRNVLSKKVMVKKDDSLDNITLFSIITLMSLFLMAPVTFFSEGIKFTPSYIQSAGVNVQQIYTKSLIAALCFHAYQQVSYMILARVSPVTHSVGNCVKR 356          

HSP 2 Score: 70.0922 bits (170), Expect = 3.093e-97
Identity = 33/38 (86.84%), Postives = 36/38 (94.74%), Query Frame = 2
Query:  575 MFFRTPVSAINAFGTGIALAGVFLYSRVKRIKPKAKTA 688
            +FF+TPVS +NAFGTGIALAGVFLYSRVKRIKPK KTA
Sbjct:  365 IFFKTPVSPVNAFGTGIALAGVFLYSRVKRIKPKPKTA 402          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: GPT2_ARATH (Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.143e-38
Identity = 79/184 (42.93%), Postives = 121/184 (65.76%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGEFPTLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEVYVRSLIA-AICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            HT+G++   +S+ KVAVSFTH IK+ EP FSVL+S  F+GE   L V  SL+PI+GG ALA++TE++FN  GF  AM SNL    RN+ SKK M  K +++  +  ++ +++MS +++ P ++ +E      A  Q+A   +   +V  ++A ++ YH Y QVSYM L ++SP+T S+GN +KR
Sbjct:  169 HTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFFMGETFPLPVYLSLLPIIGGCALAAITELNFNITGFMGAMISNLAFVFRNIFSKKGM--KGKSVSGMNYYACLSMMSLVILTPFSIAVEVPQMWAAGWQNAVSQVGPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKR 350          

HSP 2 Score: 36.1946 bits (82), Expect = 4.143e-38
Identity = 14/30 (46.67%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  575 MFFRTPVSAINAFGTGIALAGVFLYSRVKR 664
            + F TP+  +NA G  IA+ G FLYS+ K+
Sbjct:  359 IIFHTPIQPVNALGAAIAIFGTFLYSQAKQ 388          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: GPT1_ARATH (Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 7.032e-38
Identity = 81/185 (43.78%), Postives = 121/185 (65.41%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGE-FPTLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEVYVRSLIA-AICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            HT+G++   +S+ KVAVSFTH IK+ EP FSVL+S   LGE FPT  V  SLIPI+GG AL+++TE++FN  GF  AM SNL    RN+ SKK M  K +++  +  ++ ++++S +++ P  + +EG        Q+A   +   +V  ++A ++ YH Y QVSYM L ++SP+T SVGN +KR
Sbjct:  169 HTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFILGETFPTS-VYLSLIPIIGGCALSALTELNFNMIGFMGAMISNLAFVFRNIFSKKGM--KGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQMWVDGWQTALATVGPQFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKR 350          

HSP 2 Score: 38.5058 bits (88), Expect = 7.032e-38
Identity = 16/29 (55.17%), Postives = 20/29 (68.97%), Query Frame = 2
Query:  575 MFFRTPVSAINAFGTGIALAGVFLYSRVK 661
            + FRTPV  +NA G  IA+ G FLYS+ K
Sbjct:  359 IIFRTPVQPVNALGAAIAILGTFLYSQAK 387          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: TPT_PEA (Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.813e-35
Identity = 81/187 (43.32%), Postives = 120/187 (64.17%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGE-FP-TLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEV-YVRSLI-AAICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            H LG++ +N+S   VAVSFTHT+KA EPFF+   S   LG+  P TLW+  SL P++ GV++AS+TE+SFNW GF SAM SN++   R++ SKK M +    +D+  +++ I++++ I+ IP  LI+EG T        A   +  V +V  L    + YH Y QV+   L+RV+P+TH+VGN +KR
Sbjct:  172 HALGHVTSNVSFAAVAVSFTHTVKALEPFFNAAASQFILGQSIPITLWL--SLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTD----MDSTNIYAYISIIALIVCIPPALIIEGPTLLKTGFNDAIAKVGLVKFVSDLFWVGMFYHLYNQVATNTLERVAPLTHAVGNVLKR 352          

HSP 2 Score: 30.4166 bits (67), Expect = 1.813e-35
Identity = 14/29 (48.28%), Postives = 18/29 (62.07%), Query Frame = 2
Query:  575 MFFRTPVSAINAFGTGIALAGVFLYSRVK 661
            + F   +S     GTGIA+AGV LYS +K
Sbjct:  361 IIFGNKISTQTGIGTGIAIAGVALYSFIK 389          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: TPT_FLAPR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.747e-33
Identity = 78/190 (41.05%), Postives = 119/190 (62.63%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGE-FP-TLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEVYVRSLIA-----AICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            H LG++ +N+S   VAVSFTHTIK+ EPFF+   S   LG+  P TLW+  SL P++ GV++AS+TE+SFNW GF SAM SN++   R++ SKK M +    +D+  L++ I+++S +  IP  +I+EG          A   + +V +   I+      + YH Y Q++   L+RV+P+TH+VGN +KR
Sbjct:  178 HALGHVTSNVSFAAVAVSFTHTIKSLEPFFNAAASQFILGQSIPITLWL--SLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTD----MDSTNLYAYISIISLLFCIPPAIILEGPQLLKHGFSDA---IAKVGMTKFISDLFWVGMFYHLYNQLAINTLERVAPLTHAVGNVLKR 358          

HSP 2 Score: 28.4906 bits (62), Expect = 2.747e-33
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  581 FRTPVSAINAFGTGIALAGVFLYSRVK 661
            F   +S   A GT IA+AGV +YS +K
Sbjct:  369 FGNKISTQTAIGTSIAIAGVAVYSLIK 395          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: TPT1_BRAOB (Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.748e-33
Identity = 78/192 (40.62%), Postives = 121/192 (63.02%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGE-FP-TLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLN--LKEVYVRSLIA-----AICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            H +G++ +N+S   VAVSFTHTIKA EPFF+   S   LG+  P TLW+  SL P++ GVA+AS+TE+SFNW GF SAM SN++   R++ SKK M +    +D+  +++ I++++  + +P  +I+EG       L   G N  + +V +   I+      + YH Y Q++   L+RV+P+TH+VGN +KR
Sbjct:  177 HAIGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFLLGQPIPITLWL--SLAPVVLGVAMASLTELSFNWLGFISAMISNISFTYRSIFSKKAMTD----MDSTNVYAYISIIALFVCLPPAIIVEG-----PQLLKHGFNDAIAKVGMTKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKR 357          

HSP 2 Score: 30.8018 bits (68), Expect = 2.748e-33
Identity = 17/42 (40.48%), Postives = 24/42 (57.14%), Query Frame = 2
Query:  575 MFFRTPVSAINAFGTGIALAGVFLYS----RVKRIKPKAKTA 688
            + F   +S     GTGIA+AGV LYS    +++  K + KTA
Sbjct:  366 VIFGNKISTQTGIGTGIAIAGVALYSVIKAKIEEEKRQGKTA 407          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: TPT_FLATR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.341e-32
Identity = 72/185 (38.92%), Postives = 114/185 (61.62%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGEFPTLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEV-YVRSLI-AAICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            H LG++ +N+S   VAVSFTHTIKA EPFF+   S   LG+   + +  SL P++ GV++AS+TE+SFNW GF SAM SN++   R++ SKK M +    +D+  L++ I++++ +  IP  ++ EG          A   +  + ++  L    + YH Y Q++   L+RV+P+TH+VGN +KR
Sbjct:  177 HALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFVLGQSIPISLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTD----MDSTNLYAYISIIALLFCIPPAVLFEGPQLLKHGFNDAIAKVGMIKFISDLFWVGMFYHLYNQIATNTLERVAPLTHAVGNVLKR 357          

HSP 2 Score: 28.8758 bits (63), Expect = 1.341e-32
Identity = 13/27 (48.15%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  581 FRTPVSAINAFGTGIALAGVFLYSRVK 661
            F   +S   A GT IA+AGV +YS +K
Sbjct:  368 FGNKISTQTAIGTSIAIAGVAIYSLIK 394          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: TPT_SPIOL (Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.746e-32
Identity = 77/192 (40.10%), Postives = 121/192 (63.02%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGE-FP-TLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLN--LKEVYVRSLIA-----AICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            H +G++ +N+S   VAVSFTHTIKA EPFF+   S   LG+  P TLW+  SL P++ GV++AS+TE+SFNW GF SAM SN++   R++ SKK M +    +D+  +++ I++++  + +P  +I+EG       L   G N  + +V +   I+      + YH Y Q++   L+RV+P+TH+VGN +KR
Sbjct:  174 HAIGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFVLGQSIPITLWL--SLAPVVIGVSMASLTELSFNWLGFISAMISNVSFTYRSLYSKKAMTD----MDSTNIYAYISIIALFVCLPPAIIVEG-----PQLMKHGFNDAIAKVGLTKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKR 354          

HSP 2 Score: 29.6462 bits (65), Expect = 1.746e-32
Identity = 14/27 (51.85%), Postives = 17/27 (62.96%), Query Frame = 2
Query:  581 FRTPVSAINAFGTGIALAGVFLYSRVK 661
            F   +S   A GT IA+AGV LYS +K
Sbjct:  365 FGNKISTQTAIGTSIAIAGVALYSLIK 391          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: TPT_MAIZE (Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.274e-32
Identity = 75/191 (39.27%), Postives = 118/191 (61.78%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGEFP--TLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQS------AGLNLKEVYVRSLIAAICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            H +G++ +N+S   VAVSF HTIKA EPFFS   +   LG+    +LW+  SL P++ GV++AS+TE+SFNW GF +AM SN++   R++ SKK M +    +D+  +++ I++++ I+ IP  LI EG    P  +Q       A + L +      +  + YH Y Q++   L+RV+P+TH+VGN +KR
Sbjct:  180 HGIGHITSNVSFAAVAVSFAHTIKALEPFFSAAATQFILGQQVPFSLWL--SLAPVVIGVSMASLTELSFNWTGFINAMISNISFTYRSIYSKKAMTD----MDSTNVYAYISIIALIVCIPPALIFEG----PKLMQHGFSDAIAKVGLTKFVSDLFLVGLFYHLYNQIATNTLERVAPLTHAVGNVLKR 360          

HSP 2 Score: 27.335 bits (59), Expect = 2.274e-32
Identity = 12/27 (44.44%), Postives = 16/27 (59.26%), Query Frame = 2
Query:  581 FRTPVSAINAFGTGIALAGVFLYSRVK 661
            F   +S     GT IA+AGV +YS +K
Sbjct:  371 FGNKISTQTGIGTSIAIAGVAMYSYIK 397          
BLAST of DC900244 vs. ExPASy Swiss-Prot
Match: TPT_SOLTU (Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 8.514e-32
Identity = 74/189 (39.15%), Postives = 114/189 (60.32%), Query Frame = 1
Query:    1 HTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGEFPTLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQS------AGLNLKEVYVRSLIAAICYHAYQQVSYMILQRVSPVTHSVGNCVKR 549
            H LG++ +N+S   V VSFTHT+KA EPFF+   S   LG+   L +  SL P++ GV++AS+TE+SFNW GF SAM SN++   R++ SKK M +    +D+  +++ I++++ I  +P  + +EG    P  LQ       A + L +         + YH Y QV+   L+RV+P+TH+VGN +KR
Sbjct:  184 HALGHVTSNVSFAAVRVSFTHTVKALEPFFNAAASQFILGQQIPLALWLSLAPVVLGVSMASLTELSFNWLGFTSAMISNISFTYRSIYSKKAMTD----MDSTNVYAYISIIALIFCLPPAIFIEG----PQLLQHGFNDAIAKVGLTKFVTDLFWVGMFYHLYNQVATNTLERVAPLTHAVGNVLKR 364          

HSP 2 Score: 26.1794 bits (56), Expect = 8.514e-32
Identity = 12/29 (41.38%), Postives = 17/29 (58.62%), Query Frame = 2
Query:  575 MFFRTPVSAINAFGTGIALAGVFLYSRVK 661
            + F   +S     GT IA+AGV +YS +K
Sbjct:  373 VIFGNKISTQTGIGTCIAIAGVAIYSFIK 401          
The following BLAST results are available for this feature:
BLAST of DC900244 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
TPT2_BRAOB3.093e-9781.42Triose phosphate/phosphate translocator, non-green... [more]
GPT2_ARATH4.143e-3842.93Glucose-6-phosphate/phosphate translocator 2, chlo... [more]
GPT1_ARATH7.032e-3843.78Glucose-6-phosphate/phosphate translocator 1, chlo... [more]
TPT_PEA1.813e-3543.32Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLAPR2.747e-3341.05Triose phosphate/phosphate translocator, chloropla... [more]
TPT1_BRAOB2.748e-3340.63Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLATR1.341e-3238.92Triose phosphate/phosphate translocator, chloropla... [more]
TPT_SPIOL1.746e-3240.10Triose phosphate/phosphate translocator, chloropla... [more]
TPT_MAIZE2.274e-3239.27Triose phosphate/phosphate translocator, chloropla... [more]
TPT_SOLTU8.514e-3239.15Triose phosphate/phosphate translocator, chloropla... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900244 VSS Citrus sinensis cDNA clone VS28284 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900244 ID=DC900244|Name=DC900244|organism=Citrus sinensis|type=EST|length=1002bp
CACACATTGGGTAACCTCTTTACTAATATGAGTCTTGGGAAAGTGGCTGT
TTCATTCACTCACACGATTAAGGCTACGGAGCCATTCTTCTCTGTTCTCC
TATCTGCTATGTTTCTAGGGGAGTTCCCCACTCTCTGGGTTGTTGGATCT
CTAATACCTATTATGGGTGGTGTTGCGCTTGCATCAGTTACTGAGGTTTC
TTTTAATTGGGCTGGTTTCTGGAGTGCAATGGCTTCCAATTTGACAAACC
AATCTCGTAATGTCCTTAGCAAAAAAGTCATGGTGAATAAAGAGGAAGCT
TTGGACAATATCACCCTATTTTCTATAATAACAGTCATGTCTTTCATCCT
GATGATCCCCGTGACTCTCATTATGGAAGGTGTCACATTTACCCCTGCAT
ACCTACAGTCTGCTGGTTTGAATCTTAAAGAGGTTTATGTAAGGTCACTT
ATCGCTGCAATCTGTTACCATGCTTATCAGCAGGTCTCTTACATGATATT
ACAGAGGGTAAGCCCTGTTACCCATTCAGTAGGCAATTGTGTGAAGAGGG
GTGGTGGTCATCGTGAGCTCTGTTATGTTCTTCCGAACTCCAGTCTCAGC
TATCAATGCCTTTGGCACTGGGATCGCTCTTGCTGGAGTTTTCCTGTACT
CAAGGGTGAAGCGCATTAAGCCAAAGGCAAAGACTGCTTAAATTTCTTGT
GGAGAATTTTTTTTCCAGGCAATTGGGTTGTTAGTTGATAAAATTTAAGT
TGTTCATTGAGAACTTATTTTTAGGTCAGGGCAGGAACTTAATTTTTATT
TTGGGTTTGTAATCTCTTTTCTTTTTTGTTTCTCTCTTNATCTTTCTTTT
GAGATGATACATTCTTTTGTGGATTTCGCCNCAGTTATGCCGGTAGCAAA
TCAGCTGCTCTGAATTGTATCTTGTCCTTTTTGTTTAAGCCCCAATGTTT
CATCTCCCATCGGCAGTTCCTCGTTTGAATGTGAAATGTAATTTTGCTCT
TT
back to top