DC900243

Overview
NameDC900243
Unique NameDC900243
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length666
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig638 contig Csv1_Contig638:525..1169. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900243 vs. ExPASy Swiss-Prot
Match: Y3550_ARATH (REF/SRPP-like protein At3g05500 OS=Arabidopsis thaliana GN=At3g05500 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.102e-53
Identity = 102/150 (68.00%), Postives = 124/150 (82.67%), Query Frame = 1
Query:    1 DESVTKLDCRVPPVLKQVPAQALSAAQMAPVVARSVASEVKTAGVAGTASGMAKSVYTKYEPAAKELYSKYEPKAEQYAVSAWRKLNQMPLFXXXXXXXXXXXXYCSEKYNQTVVSAADKGYKVSSYLPLVPTERIAKVFSNGVVESQPL 450
            D SVT+LD RVPPV+KQV AQA+SAAQ+AP+VAR++ASEV+ AGV  TASGMAKSVY+KYEPAAKELY+ YEPKAEQ AVSAW+KLNQ+PLF            +CSEKYN TVV AA+KGY+V+SY+PLVPTERI+K+F+    E++PL
Sbjct:   91 DMSVTELDRRVPPVVKQVSAQAISAAQIAPIVARALASEVRRAGVVETASGMAKSVYSKYEPAAKELYANYEPKAEQCAVSAWKKLNQLPLFPRLAQVAVPTAAFCSEKYNDTVVKAAEKGYRVTSYMPLVPTERISKIFAEEKAETEPL 240          
BLAST of DC900243 vs. ExPASy Swiss-Prot
Match: SRP_VITRI (Stress-related protein OS=Vitis riparia GN=SRP PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.368e-36
Identity = 77/143 (53.85%), Postives = 100/143 (69.93%), Query Frame = 1
Query:    1 DESVTKLDCRVPPVLKQVPAQALSAAQMAPVVARSVASEVKTAGVAGTASGMAKSVYTKYEPAAKELYSKYEPKAEQYAVSAWRKLNQMPLFXXXXXXXXXXXXYCSEKYNQTVVSAADKGYKVSSYLPLVPTERIAKVFSNG 429
            + S+ +L+  VP ++K+   QA++ AQ AP +A +VASEV+  GV  TA  + K+VY+K EP AKEL SKYEP AEQYAVSAWR LN++PLF            Y SEKYNQ+V   A++GY V+ YLPL+PTERIAKVF +G
Sbjct:   89 EASIYELERHVPSLVKRASCQAITVAQKAPELALAVASEVQRPGVVDTAKNITKNVYSKCEPTAKELCSKYEPVAEQYAVSAWRSLNRLPLFPQVAQVVVPTAAYWSEKYNQSVSYTAERGYTVALYLPLIPTERIAKVFQDG 231          
BLAST of DC900243 vs. ExPASy Swiss-Prot
Match: SRP_PHAVU (Stress-related protein OS=Phaseolus vulgaris GN=SRP PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.477e-27
Identity = 70/141 (49.65%), Postives = 86/141 (60.99%), Query Frame = 1
Query:    1 DESVTKLDCRVPPVLKQVPAQALSAAQMAPVVARSVASEVKTAGVAGTASGMAKSVYTKYEPAAKELYSKYEPKAEQYAVSAWRKLNQMPLFXXXXXXXXXXXXYCSEKYNQTVVSAADKGYKVSSYLPLVPTERIAKVFS 423
            D  V +LD  VP  +K+V +QA           RSV SEV+  GV+                 AK +YSKYEP AEQ AVSAWRKLNQ+PLF            YC+EKYN+ +VS+A+KGY+VS+YLPLVPTE+IAKVFS
Sbjct:   51 DRKVGELDRHVPSNVKKVSSQA-----------RSVVSEVRRDGVS---------------TFAKTVYSKYEPTAEQCAVSAWRKLNQLPLFPQVANAVLPKAAYCTEKYNEVIVSSAEKGYRVSAYLPLVPTEKIAKVFS 165          
BLAST of DC900243 vs. ExPASy Swiss-Prot
Match: Y5513_ORYSJ (REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 OS=Oryza sativa subsp. japonica GN=Os05g0151300 PE=2 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.303e-26
Identity = 67/152 (44.08%), Postives = 91/152 (59.87%), Query Frame = 1
Query:    4 ESVTKLDCRVPPVLKQVPAQALSAAQMAPVVARSVASEVKTAGVAGTASGMAKSVYTKYEPAAKELYSKYEPKAEQYAVSAWRKLNQMPLFXXXXXXXXXXXXYCSEKYNQTVVSAADKGYKVSSYLPLVPTERIAKVFSNGVVESQPLASA 459
            ESV +LD RVPPV+K+           AP +ARS A+EV+ AG+ GTA+G+AKS   + EP A++LY++YEP AE+ A  AW  LN++PL               S +YN  V   A +G  V++YLPLVPTER+++VF        PLA A
Sbjct:  105 ESVQELDRRVPPVVKE-----------APGLARSAAAEVRQAGLVGTATGLAKSAIARAEPRARDLYTRYEPVAERKAAEAWAALNRLPLVPSVTRAVLPAAASLSARYNTAVADGAKRGSAVATYLPLVPTERLSRVF------GYPLADA 239          
BLAST of DC900243 vs. ExPASy Swiss-Prot
Match: Y5513_ORYSI (REF/SRPP-like protein OsI_017815 OS=Oryza sativa subsp. indica GN=OsI_017815 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.303e-26
Identity = 67/152 (44.08%), Postives = 91/152 (59.87%), Query Frame = 1
Query:    4 ESVTKLDCRVPPVLKQVPAQALSAAQMAPVVARSVASEVKTAGVAGTASGMAKSVYTKYEPAAKELYSKYEPKAEQYAVSAWRKLNQMPLFXXXXXXXXXXXXYCSEKYNQTVVSAADKGYKVSSYLPLVPTERIAKVFSNGVVESQPLASA 459
            ESV +LD RVPPV+K+           AP +ARS A+EV+ AG+ GTA+G+AKS   + EP A++LY++YEP AE+ A  AW  LN++PL               S +YN  V   A +G  V++YLPLVPTER+++VF        PLA A
Sbjct:  105 ESVQELDRRVPPVVKE-----------APGLARSAAAEVRQAGLVGTATGLAKSAIARAEPRARDLYTRYEPVAERKAAEAWAALNRLPLVPSVTRAVLPAAASLSARYNTAVADGAKRGSAVATYLPLVPTERLSRVF------GYPLADA 239          
BLAST of DC900243 vs. ExPASy Swiss-Prot
Match: SRPP_HEVBR (Small rubber particle protein OS=Hevea brasiliensis GN=SRPP PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.222e-26
Identity = 68/142 (47.89%), Postives = 80/142 (56.34%), Query Frame = 1
Query:    1 DESVTKLDCRVPPVLKQVPAQALSAAQMAPVVARSVASEVKTAGVAGTASGMAKSVYTKYEPAAKELYSKYEPKAEQYAVSAWRKLNQMPLFXXXXXXXXXXXXYCSEKYNQTVVSAADKGYKVSSYLPLVPTERIAKVFSN 426
            D SVT LD  VPPV+KQV AQ  S AQ AP +   VAS V   GV               +  AK LY+  EPKAEQYAV  WR LN++PL             Y SEKYN  V    ++GY+VSSYLPL+PTE+I KVF +
Sbjct:   75 DVSVTSLDGVVPPVIKQVSAQTYSVAQDAPRIVLDVASSVFNTGV---------------QEGAKALYANLEPKAEQYAVITWRALNKLPLVPQVANVVVPTAVYFSEKYNDVVRGTTEQGYRVSSYLPLLPTEKITKVFGD 201          
BLAST of DC900243 vs. ExPASy Swiss-Prot
Match: Y2778_ARATH (REF/SRPP-like protein At2g47780 OS=Arabidopsis thaliana GN=At2g47780 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.351e-15
Identity = 50/139 (35.97%), Postives = 70/139 (50.36%), Query Frame = 1
Query:    1 DESVTKLDCRVPPVLKQVPAQALSAAQMAPVVARSVASEVKTAGVAGTASGMAKSVYTKYEPAAKELYSKYEPKAEQYAVSAWRKLNQMPLFXXXXXXXXXXXXYCSEKYNQTVVSAADKGYKVSSYLPLVPTERIAKV 417
            D+    ++  VP ++KQ  +QAL+           VA+EV+  GV  T   +A+SV  KYEPA           AE YA + WR LNQ+PLF            Y SEKYN  V    D+ Y  + YLP++P E+I+ +
Sbjct:  110 DDVFFDVETYVPSLVKQASSQALT-----------VATEVQRTGVVDTTKSIARSVRDKYEPA-----------AEYYAATLWRLLNQLPLFPEVAHLVIPTAFYWSEKYNDAVRYVGDRDYFGAEYLPMIPIEKISDI 226          
The following BLAST results are available for this feature:
BLAST of DC900243 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
Y3550_ARATH8.102e-5368.00REF/SRPP-like protein At3g05500 OS=Arabidopsis tha... [more]
SRP_VITRI2.368e-3653.85Stress-related protein OS=Vitis riparia GN=SRP PE=... [more]
SRP_PHAVU4.477e-2749.65Stress-related protein OS=Phaseolus vulgaris GN=SR... [more]
Y5513_ORYSJ1.303e-2644.08REF/SRPP-like protein Os05g0151300/LOC_Os05g05940 ... [more]
Y5513_ORYSI1.303e-2644.08REF/SRPP-like protein OsI_017815 OS=Oryza sativa s... [more]
SRPP_HEVBR2.222e-2647.89Small rubber particle protein OS=Hevea brasiliensi... [more]
Y2778_ARATH1.351e-1535.97REF/SRPP-like protein At2g47780 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900243 VSS Citrus sinensis cDNA clone VS28283 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900243 ID=DC900243|Name=DC900243|organism=Citrus sinensis|type=EST|length=666bp
GATGAGTCTGTGACCAAGCTGGACTGCCGTGTGCCTCCAGTCCTCAAGCA
AGTCCCTGCCCAAGCTCTCTCCGCTGCTCAAATGGCTCCCGTAGTGGCAC
GATCCGTGGCTTCTGAAGTGAAGACTGCCGGTGTAGCCGGCACTGCCTCA
GGAATGGCAAAATCCGTTTACACCAAGTACGAGCCAGCAGCCAAGGAACT
TTACTCCAAGTACGAACCAAAAGCGGAGCAATATGCTGTGTCAGCTTGGC
GCAAGCTCAATCAGATGCCACTATTCCCTCAAGTAGCTCAAGTTGTTGTG
CCAACTGCTGCCTATTGTTCCGAAAAATACAACCAAACAGTGGTGAGCGC
TGCAGATAAGGGGTACAAGGTCTCCTCATATTTGCCTTTGGTCCCTACTG
AGAGGATTGCTAAGGTGTTCAGCAACGGGGTTGTTGAATCGCAGCCTCTG
GCTTCTGCTGGACATGAAGCTGATGTTGTTGTGCATTGATAGCTGTGTTT
TCTGTTTTCTGTTTTCTGGCCTCACAATTTTTCTTGCAAGCTGTGGAGTG
AAAATGTTTCCCTTTCTGGATGTGTATTGGGTTGAAAATGGAGTGGATTA
CGATTATTTAATTTTTAAAGACATTGCTTAATTCTGTGGCGTCAGCATAA
TACTTTCTGTTTTGAC
back to top