DC900241

Overview
NameDC900241
Unique NameDC900241
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length700
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3636 contig Csv1_Contig3636:40..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: FHIT_DICDI (Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.154e-38
Identity = 77/149 (51.68%), Postives = 100/149 (67.11%), Query Frame = 3
Query:  132 FGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQXADQYRSLF 578
            FGP+ I   E+F++T LS+A+VNL+P+LPGHVLVC +R   R  DLT +E TDLWL+AQ++   +E +  G   TFAIQDG  AGQTV HVHIH++PRK  DFE ND+IY+ IE             KER+ RS EEM + + + R LF
Sbjct:    6 FGPWLIRQSEIFFTTELSFALVNLKPVLPGHVLVCPKRIVPRVKDLTKEEFTDLWLSAQRISSVVEEHFNGDGITFAIQDGKNAGQTVEHVHIHIIPRKKFDFENNDQIYNEIE-------------KEREPRSYEEMEKESSELRPLF 141          
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: FHIT_BOVIN (Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=FHIT PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.760e-36
Identity = 76/151 (50.33%), Postives = 100/151 (66.23%), Query Frame = 3
Query:  126 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQXADQYRSLF 578
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF D++ +E  DL+  AQ+VG  +E + +G+S TF++QDGPEAGQTV HVH+H+LPRKAGDF +ND IYDA+E  ++E     D D     RS EEM   A   R  F
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQAAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKAGDFHRNDSIYDALEKHDRE-----DKDSPALWRSEEEMAAEAAALRVYF 148          
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: FHIT_HUMAN (Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3)

HSP 1 Score: 145.976 bits (367), Expect = 1.853e-34
Identity = 76/151 (50.33%), Postives = 96/151 (63.58%), Query Frame = 3
Query:  126 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQXADQYRSLF 578
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF DL  DE  DL+ T Q+VG  +E +  G+S TF++QDGPEAGQTV HVH+HVLPRKAGDF +ND IY+ ++  +KE       D     RS EEM   A   R  F
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKE-------DFPASWRSEEEMAAEAAALRVYF 146          
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: FHIT_RAT (Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus GN=Fhit PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.420e-34
Identity = 72/151 (47.68%), Postives = 99/151 (65.56%), Query Frame = 3
Query:  126 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQXADQYRSLF 578
            F FG + I    VF  T LS+A+VN +P++PGHVL+C  R  +RF DL  DE  DL+   Q+VG  +E + +G+S TF++QDGPEAGQTV HVH+H+LPRK+GDF +ND IYD ++  ++E     + D     RS EEM   A+  R+ F
Sbjct:    3 FKFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLMCPLRPVERFRDLRPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHILPRKSGDFRRNDNIYDELQKHDRE-----EEDSPAFWRSEEEMAAEAEVLRAYF 148          
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: FHIT_MOUSE (Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN=Fhit PE=2 SV=3)

HSP 1 Score: 145.206 bits (365), Expect = 3.161e-34
Identity = 74/151 (49.01%), Postives = 98/151 (64.90%), Query Frame = 3
Query:  126 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQXADQYRSLF 578
            F FG + I    VF  T LS+A+VN +P++PGHVLVC  R  +RF DL  DE  DL+   Q+VG  +E + +G+S TF++QDGPEAGQTV HVH+HVLPRKAGDF +ND IYD ++  ++E     + D     RS +EM   A+  R  F
Sbjct:    3 FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDRE-----EEDSPAFWRSEKEMAAEAEALRVYF 148          
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: NFT1_CAEEL (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 5.961e-33
Identity = 76/155 (49.03%), Postives = 96/155 (61.94%), Query Frame = 3
Query:  111 SSTTQFTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQXADQYRSL 575
            S T    F  + I A  +FYSTP S+  VNL+P+  GHVLV  +R   R  DLT  ET DL++ A+KV   LE +H  +STT  +QDG +AGQTVPHVHIH+LPR+AGDF  N EIY  +   +KE         ERK RS E+M + A  YR+L
Sbjct:  294 SETGGLKFARFNIPADHIFYSTPHSFVFVNLKPVTDGHVLVSPKRVVPRLTDLTDAETADLFIVAKKVQAMLEKHHNVTSTTICVQDGKDAGQTVPHVHIHILPRRAGDFGDN-EIYQKLASHDKE--------PERKPRSNEQMAEEAVVYRNL 439          
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: APH1_SCHPO (Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe GN=aph1 PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 2.344e-29
Identity = 69/173 (39.88%), Postives = 97/173 (56.07%), Query Frame = 3
Query:  123 QFTFGPYKIDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKEL---------------------QQKLDLDKERKDRSLEEMNQXADQYRSLF 578
            Q  F  + + + +VFY T LS A VNL+P+LPGHVLV  +R   R  DLT  E TDL+ + +KV + +E     S++   IQDG +AGQTVPHVH+H++PRK  DF +ND +Y  +E  E  L                     +Q +  D++RK R+LEEM + A   +  F
Sbjct:    4 QLYFSKFPVGS-QVFYRTKLSAAFVNLKPILPGHVLVIPQRAVPRLKDLTPSELTDLFTSVRKVQQVIEKVFSASASNIGIQDGVDAGQTVPHVHVHIIPRKKADFSENDLVYSELEKNEGNLASLYLTGNERYAGDERPPTSMRQAIPKDEDRKPRTLEEMEKEAQWLKGYF 175          
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: NFT1_DROME (Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster GN=NitFhit PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.075e-22
Identity = 52/141 (36.88%), Postives = 81/141 (57.45%), Query Frame = 3
Query:  147 IDAKEVFYSTPLSYAMVNLRPLLPGHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQXADQYR 569
            +D + +FY +   +A  NLR ++ GHVLV ++R   R   L   E  D++ T   V + LE  ++ +S T  +QDG +AGQTVPHVH H++PR+ GDF  ND+IY  ++ +           +E+  R++EE  + A  YR
Sbjct:  323 VDKRTIFYESEHCFAFTNLRCVVKGHVLVSTKRVTPRLCGLDCAEMADMFTTVCLVQRLLEKIYQTTSATVTVQDGAQAGQTVPHVHFHIMPRRLGDFGHNDQIYVKLDERA----------EEKPPRTIEERIEEAQIYR 453          
BLAST of DC900241 vs. ExPASy Swiss-Prot
Match: HNT2_YEAST (Hit family protein 2 OS=Saccharomyces cerevisiae GN=HNT2 PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 7.074e-18
Identity = 45/107 (42.06%), Postives = 69/107 (64.49%), Query Frame = 3
Query:  156 KEVFYSTPLSYAMVNLRPLLPGHVLVCS-RREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIE 473
            ++VFY +  +YA+VNL+P++PGHVL+   R      +DLT  E+ D + T Q + + ++  +K  S   AIQDGPEAGQ+VPH+H H++PR   +    D IYD ++
Sbjct:   14 EQVFYKSKYTYALVNLKPIVPGHVLIVPLRTTVLNLSDLTMPESQDYFKTLQLIHRFIKWQYKADSINVAIQDGPEAGQSVPHLHTHIIPRYKIN-NVGDLIYDKLD 119          
The following BLAST results are available for this feature:
BLAST of DC900241 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
FHIT_DICDI6.154e-3851.68Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium d... [more]
FHIT_BOVIN5.760e-3650.33Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=F... [more]
FHIT_HUMAN1.853e-3450.33Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN... [more]
FHIT_RAT2.420e-3447.68Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegic... [more]
FHIT_MOUSE3.161e-3449.01Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN... [more]
NFT1_CAEEL5.961e-3349.03Nitrilase and fragile histidine triad fusion prote... [more]
APH1_SCHPO2.344e-2939.88Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] ... [more]
NFT1_DROME8.075e-2236.88Nitrilase and fragile histidine triad fusion prote... [more]
HNT2_YEAST7.074e-1842.06Hit family protein 2 OS=Saccharomyces cerevisiae G... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900241 VSS Citrus sinensis cDNA clone VS28281 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900241 ID=DC900241|Name=DC900241|organism=Citrus sinensis|type=EST|length=700bp
CAGGTGTCTTCTTGGTACCTCTCGCATTCATAAAACGGTGCCGCTCAATC
TCCAGCACCACCATCACTCTCCCCAAGGCAAGTAAAATCAAATCGGCCTC
AGCTCAGATGTCGTCGACGACTCAGTTTACGTTCGGGCCTTACAAAATTG
ATGCGAAGGAAGTGTTCTATAGCACTCCTCTCTCCTACGCCATGGTCAAC
CTGCGCCCGTTGCTTCCTGGTCATGTACTTGTCTGCTCGAGGCGTGAAGC
AAAGCGCTTTGCTGATCTTACAGCTGATGAGACTACTGATTTATGGCTCA
CAGCCCAAAAGGTTGGCAAACAGCTCGAAAGCTACCACAAGGGTTCATCA
ACAACATTTGCCATCCAAGATGGGCCTGAAGCTGGACAGACAGTACCCCA
TGTTCACATCCATGTTCTCCCGCGCAAAGCTGGTGACTTTGAAAAAAATG
ATGAGATTTATGATGCAATAGAGGTGAAGGAGAAGGAATTACAGCAGAAG
CTTGATTTGGATAAGGAAAGGAAGGACAGAAGCCTCGAGGAGATGAATCA
AAANGCTGATCAATACAGGTCGCTTTTCCTGTGAAAATTTAGCAGTGCCT
TTCATTAGGCTTCTCTTGAACGTTCGCCAAAGCTGCCAGAAACTTCAGGC
CTCTAAATAAAATACTTCATGAAATTTTATTAGTGTTTCTAAAGACATTG
back to top