DC900215

Overview
NameDC900215
Unique NameDC900215
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length840
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5343 contig Csv1_Contig5343:486..1325. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP_TOBAC (Uroporphyrinogen decarboxylase, chloroplastic OS=Nicotiana tabacum GN=DCUP PE=1 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 1.393e-125
Identity = 219/256 (85.55%), Postives = 245/256 (95.70%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAIRY 768
            IKGKGPVIFDP+ T A+V++VREF PE+SVPYVG+ALTILR+EVNN+AAVLGFVGAPFTLASYVVEGGSSK+F+KIKRLAF++PKVLHALL+KF TSMAKY++YQAD+GAQAVQIFDSWATELSPVDFEEFSLPYLKQIVD+VK THP+L LILYASGSGGLLERL LTGVDVVSLDWTVDMA+GRRRLGP+VA+QGNVDPG LFGSK+FITNRINDTV+KAG+ KHILNLGHGIKVGTPEEN AHFFE+AK +RY
Sbjct:  136 IKGKGPVIFDPLRTAADVEKVREFIPEKSVPYVGEALTILRKEVNNQAAVLGFVGAPFTLASYVVEGGSSKNFTKIKRLAFAEPKVLHALLQKFATSMAKYIRYQADSGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDSVKLTHPNLPLILYASGSGGLLERLPLTGVDVVSLDWTVDMADGRRRLGPNVAIQGNVDPGVLFGSKEFITNRINDTVKKAGKGKHILNLGHGIKVGTPEENFAHFFEIAKGLRY 391          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP2_ORYSJ (Uroporphyrinogen decarboxylase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0337600 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 7.908e-121
Identity = 213/256 (83.20%), Postives = 237/256 (92.58%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAIRY 768
            +KGKGPVIFDP+ T A V++VREF PEE VPYVG+AL ILREEVNNEAAVLGFVGAPFTLASY VEGGSSK+FSKIK++AFS+P++LH LL+KFTTSMA Y++YQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVD+VK+THP+L LILYASGSGGLLERL LTGVDVVSLDWTVDMAEGR+RLG ++AVQGNVDPG LFGSK+FI+ RI DTV+KAG   H+LNLGHGIKVGTPEENVAHFFEVAK IRY
Sbjct:  135 VKGKGPVIFDPLRTAAAVNEVREFVPEEWVPYVGQALNILREEVNNEAAVLGFVGAPFTLASYCVEGGSSKNFSKIKKMAFSEPEILHNLLQKFTTSMANYIKYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDSVKETHPELPLILYASGSGGLLERLPLTGVDVVSLDWTVDMAEGRKRLGSNIAVQGNVDPGVLFGSKEFISKRIFDTVQKAGNSGHVLNLGHGIKVGTPEENVAHFFEVAKGIRY 390          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP2_ARATH (Uroporphyrinogen decarboxylase 2, chloroplastic OS=Arabidopsis thaliana GN=At2g40490 PE=1 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 1.762e-120
Identity = 215/256 (83.98%), Postives = 238/256 (92.97%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAIRY 768
            +KGKGP+IF+P  + A+V QVREF PEESVPYVG+AL  LR EVNNEAAVLGFVGAPFTL+SYV+EGGSSK+F++IKRLAFSQPKVLHALL+KFTTSM  Y++YQAD+GAQAVQIFDSWATELSPVDFEEFSLPYLKQIV+ VKQTHP+L LILYASGSGGLLERLA TGVDVVSLDWTVDMAEGR RLG D+AVQGNVDPG LFGSK+FIT+RI+DTV+KAGR KHILNLGHGIKVGTPEENVAHFFEVA+ IRY
Sbjct:  139 VKGKGPIIFNPPQSAADVAQVREFVPEESVPYVGEALRRLRNEVNNEAAVLGFVGAPFTLSSYVIEGGSSKNFTQIKRLAFSQPKVLHALLQKFTTSMITYIRYQADSGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVEAVKQTHPNLPLILYASGSGGLLERLARTGVDVVSLDWTVDMAEGRDRLGRDIAVQGNVDPGVLFGSKEFITSRIHDTVKKAGRDKHILNLGHGIKVGTPEENVAHFFEVAQEIRY 394          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP_HORVU (Uroporphyrinogen decarboxylase (Fragment) OS=Hordeum vulgare GN=DCUP PE=2 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 1.491e-119
Identity = 211/256 (82.42%), Postives = 234/256 (91.41%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAIRY 768
            +KGKGPVI+DP+ T A V++VREF PEE VPYVG+AL +LR EV NEAAVLGFVGAPFTLASY VEGGSSK+FSKIKR+AF++P +LH LL+KFTTSMA Y++YQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVD+VK+THPDL LILYASGSGGLLERL LTGVDVVSLDWTVDMAEGR+RLG ++AVQGNVDPG LFGSK+FIT RI DTV+KAG   H+LNLGHGIKVGTPEENVAHFFEVAK IRY
Sbjct:   75 VKGKGPVIYDPLRTAAAVNEVREFVPEEWVPYVGQALNLLRGEVKNEAAVLGFVGAPFTLASYCVEGGSSKNFSKIKRMAFAEPAILHNLLQKFTTSMANYIKYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDSVKETHPDLPLILYASGSGGLLERLPLTGVDVVSLDWTVDMAEGRKRLGSNIAVQGNVDPGVLFGSKEFITKRIYDTVQKAGSQGHVLNLGHGIKVGTPEENVAHFFEVAKGIRY 330          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP_MAIZE (Uroporphyrinogen decarboxylase, chloroplastic OS=Zea mays GN=LES22 PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 6.266e-118
Identity = 208/256 (81.25%), Postives = 232/256 (90.62%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAIRY 768
            +KGKGPVI+DP+ T A V++VREF PEE VPYVG+AL ILR+EV NEAAVLGFVGAPFTLASY VEGGSSK+F+ IK++AFS+P +LH LL+KFTTSMA Y++YQADNGAQAVQIFDSWATELSP DFEEFSLPYLKQIVD+V++THPDL LILYASGSGGLLERL LTGVDVVSLDWTVDMAEGR+RLG + AVQGNVDPG LFGSK+FIT RI DTV+KAG   H+LNLGHGIKVGTPEENVAHFFEVAK IRY
Sbjct:  138 VKGKGPVIYDPLRTAAAVNEVREFVPEEWVPYVGQALNILRQEVKNEAAVLGFVGAPFTLASYCVEGGSSKNFTLIKKMAFSEPAILHNLLQKFTTSMANYIKYQADNGAQAVQIFDSWATELSPADFEEFSLPYLKQIVDSVRETHPDLPLILYASGSGGLLERLPLTGVDVVSLDWTVDMAEGRKRLGSNTAVQGNVDPGVLFGSKEFITRRIYDTVQKAGNVGHVLNLGHGIKVGTPEENVAHFFEVAKGIRY 393          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP_CYAA5 (Uroporphyrinogen decarboxylase OS=Cyanothece sp. (strain ATCC 51142) GN=hemE PE=3 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 2.322e-88
Identity = 156/254 (61.42%), Postives = 199/254 (78.35%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAI 762
            ++ KGPVI  PI T  +VD +R  DPEES+P++   L  LR+EV N++ VLGFVG+P+TLA+Y +EG SSK+++ IK +AFSQP++LH+ L K   ++A YV+YQ D GAQ VQ+FDSWA +LSP D+E F+LPY +Q+V  VK+THPD  LILY SGS G+LER+  +GVD+VS+DWTVDMAE R+RLG D+ VQGN+DPG LFGS+DFI  RI DTVRKAGR  HILNLGHG+ VGTPE+NV  FFE AK +
Sbjct:   93 VESKGPVIDPPIRTKEQVDNLRPLDPEESLPFIKTILQSLRQEVGNQSTVLGFVGSPWTLAAYAIEGKSSKNYAIIKSMAFSQPEILHSFLSKIADAIAIYVRYQIDCGAQVVQLFDSWAGQLSPQDYETFALPYQQQVVRQVKETHPDTPLILYISGSAGVLERMGQSGVDIVSVDWTVDMAEARQRLGRDMKVQGNIDPGVLFGSQDFIKARILDTVRKAGRGGHILNLGHGVLVGTPEDNVRCFFETAKQV 346          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP_SYNP2 (Uroporphyrinogen decarboxylase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=hemE PE=3 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 2.174e-86
Identity = 151/255 (59.22%), Postives = 196/255 (76.86%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAIR 765
            I+ KGP+I +PI T A+VD +  FDP ES+P++   L  LR+EV N + VLGFVGAP+TLA+Y +EG SSK+++ IK +AFS+P VLH+ L K   ++A YV YQ + GAQ +Q+FDSWA +LSP D++ F+LPY K++VD VK  +PD  LILY SGS G+LER+  +GVD+VS+DWTVDMA+ R+RLG D+ VQGN+DPG LFGS+DFI  RI DTVRKAG W HILNLGHG+ VGTPE+NV  FFE  K ++
Sbjct:   93 IESKGPIIENPIRTQAQVDAMTPFDPAESLPFIKTILGTLRQEVGNASTVLGFVGAPWTLAAYAIEGKSSKNYAIIKNMAFSEPAVLHSFLGKIADAIADYVCYQIECGAQVIQMFDSWAGQLSPQDYDMFALPYQKRVVDKVKAKYPDFPLILYISGSAGVLERMGKSGVDIVSVDWTVDMADARQRLGKDMKVQGNIDPGVLFGSQDFIKARIIDTVRKAGNWGHILNLGHGVLVGTPEDNVRFFFETCKNVQ 347          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP_CYAP7 (Uroporphyrinogen decarboxylase OS=Cyanothece sp. (strain PCC 7424) GN=hemE PE=3 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.409e-85
Identity = 150/252 (59.52%), Postives = 194/252 (76.98%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAK 756
            I+ KGP+I  PI T  ++D +  FDP+++VP+V   L  LR+EV N++ VLGFVGAP+TLA+Y VEG SSK +S IK +AFS+P +LH LL K    +A YV+YQ D GAQ VQ+FDSWA +L+P D++ F+LPY +Q+V  VK+THPD  LILY SGS G+LER+  +GVD++S+DWTVDMAE R+RLG ++ VQGN+DPG LFGS+ FI +RI DT+RKAG   HILNLGHG+ VGTPE+NV  FFE AK
Sbjct:   93 IESKGPIIDPPIRTQQQIDHLHPFDPDQTVPFVKTILKTLRQEVGNQSTVLGFVGAPWTLAAYAVEGKSSKTYSIIKSMAFSEPAILHQLLSKLADMVASYVRYQIDCGAQVVQMFDSWAGQLTPQDYDVFALPYQQQVVRQVKETHPDTPLILYISGSAGVLERMGKSGVDMISVDWTVDMAEARQRLGKEMKVQGNIDPGVLFGSQSFIRDRIVDTIRKAGNQGHILNLGHGVLVGTPEDNVRFFFETAK 344          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP_SYNY3 (Uroporphyrinogen decarboxylase OS=Synechocystis sp. (strain PCC 6803) GN=hemE PE=3 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.840e-85
Identity = 149/254 (58.66%), Postives = 195/254 (76.77%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAI 762
            I+ KGP+I  PI T A+VDQ+   DPE S+P++   L  LR+EV N++ VLGFVGAP+TLA+Y +EG SSK +  IK++AFS+P +LH+ L K   ++A YV+YQ D GAQ VQ+FDSWA +LSP D++ F+LPY +++V  VK+ HPD  LILY SGS G+LER+  +GVD+VS+DWTVDMA+ R+RLG ++ VQGN+DPG LFGS+DFI  RI DTVRKAG+  HI NLGHG+ VGTPE+NV  FFE AK +
Sbjct:   93 IESKGPIIDPPIRTQAQVDQLHALDPESSLPFIKTILGTLRKEVGNQSTVLGFVGAPWTLAAYAIEGKSSKDYKVIKQMAFSEPAILHSFLDKIAEAIAVYVRYQIDCGAQVVQLFDSWAGQLSPQDYDTFALPYQQKVVKLVKEIHPDTPLILYISGSAGILERMGKSGVDIVSVDWTVDMADARQRLGKEMKVQGNMDPGVLFGSQDFIKERILDTVRKAGQGGHIFNLGHGVLVGTPEDNVRFFFETAKQV 346          
BLAST of DC900215 vs. ExPASy Swiss-Prot
Match: DCUP_MICAN (Uroporphyrinogen decarboxylase OS=Microcystis aeruginosa (strain NIES-843) GN=hemE PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.193e-84
Identity = 149/256 (58.20%), Postives = 192/256 (75.00%), Query Frame = 1
Query:    1 IKGKGPVIFDPINTDAEVDQVREFDPEESVPYVGKALTILREEVNNEAAVLGFVGAPFTLASYVVEGGSSKHFSKIKRLAFSQPKVLHALLRKFTTSMAKYVQYQADNGAQAVQIFDSWATELSPVDFEEFSLPYLKQIVDTVKQTHPDLSLILYASGSGGLLERLALTGVDVVSLDWTVDMAEGRRRLGPDVAVQGNVDPGALFGSKDFITNRINDTVRKAGRWKHILNLGHGIKVGTPEENVAHFFEVAKAIRY 768
            I+ KGP+I  PI T A+VDQ+   DP++S+P++   L  LR+EV N++ VLGFVGAP+TLA+Y VEG  SK +S IK +AFS+P VLH  L K    +A YV+YQ D GAQ VQ+FDSWA +L+P D++ F+LPY +++V  VK+THPD  LILY SGS G+LER+  +GVD++S+DWTVD+AE R+RLG  + VQGN+DPG LFGS+ FI  RI DT+RKAG   HILNLGHG+ VGTPE+NV  FFE AK   Y
Sbjct:   93 IESKGPIIDSPIRTQAQVDQLNPLDPDQSLPFIKTILKTLRQEVGNKSTVLGFVGAPWTLAAYAVEGKGSKSYSVIKGMAFSEPSVLHQFLDKLADMIATYVRYQIDCGAQVVQMFDSWAGQLTPQDYDVFALPYQQKVVRLVKETHPDTPLILYISGSAGVLERMGKSGVDIISVDWTVDLAEARQRLGKAMMVQGNIDPGVLFGSQSFIRERIIDTIRKAGNQGHILNLGHGVLVGTPEDNVRFFFETAKQFSY 348          
The following BLAST results are available for this feature:
BLAST of DC900215 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DCUP_TOBAC1.393e-12585.55Uroporphyrinogen decarboxylase, chloroplastic OS=N... [more]
DCUP2_ORYSJ7.908e-12183.20Uroporphyrinogen decarboxylase 2, chloroplastic OS... [more]
DCUP2_ARATH1.762e-12083.98Uroporphyrinogen decarboxylase 2, chloroplastic OS... [more]
DCUP_HORVU1.491e-11982.42Uroporphyrinogen decarboxylase (Fragment) OS=Horde... [more]
DCUP_MAIZE6.266e-11881.25Uroporphyrinogen decarboxylase, chloroplastic OS=Z... [more]
DCUP_CYAA52.322e-8861.42Uroporphyrinogen decarboxylase OS=Cyanothece sp. (... [more]
DCUP_SYNP22.174e-8659.22Uroporphyrinogen decarboxylase OS=Synechococcus sp... [more]
DCUP_CYAP71.409e-8559.52Uroporphyrinogen decarboxylase OS=Cyanothece sp. (... [more]
DCUP_SYNY31.840e-8558.66Uroporphyrinogen decarboxylase OS=Synechocystis sp... [more]
DCUP_MICAN1.193e-8458.20Uroporphyrinogen decarboxylase OS=Microcystis aeru... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900215 VSS Citrus sinensis cDNA clone VS28251 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900215 ID=DC900215|Name=DC900215|organism=Citrus sinensis|type=EST|length=840bp
ATCAAGGGTAAGGGTCCTGTCATATTTGATCCTATAAACACAGATGCAGA
AGTTGACCAAGTGAGAGAATTTGATCCTGAGGAGTCAGTTCCATATGTTG
GGAAAGCATTGACAATCTTGCGAGAAGAGGTAAACAATGAAGCAGCAGTT
CTGGGTTTTGTTGGGGCTCCTTTCACCCTGGCGTCATATGTGGTTGAGGG
TGGTTCATCGAAGCACTTCAGCAAAATAAAGCGACTAGCTTTCTCTCAAC
CCAAGGTCCTCCATGCATTGCTTCGGAAATTTACAACCTCTATGGCAAAG
TATGTACAATACCAAGCTGACAATGGAGCTCAAGCAGTTCAAATCTTCGA
TTCATGGGCCACGGAGCTCAGTCCTGTTGATTTTGAAGAGTTTAGTCTGC
CTTACTTGAAGCAAATTGTAGACACTGTGAAACAAACACATCCTGATCTC
TCATTAATCCTTTATGCCAGTGGATCTGGTGGCTTGCTTGAGAGGCTAGC
TTTGACAGGTGTGGATGTTGTTAGCTTGGACTGGACAGTTGACATGGCTG
AAGGTAGACGGCGACTTGGGCCCGACGTTGCAGTTCAAGGAAATGTCGAT
CCTGGTGCACTTTTCGGTTCAAAGGACTTCATCACCAACCGGATAAATGA
TACCGTGAGGAAAGCAGGTAGATGGAAACATATTTTAAATCTTGGTCACG
GCATTAAAGTAGGTACACCTGAGGAAAATGTTGCTCATTTCTTCGAAGTT
GCTAAAGCAATTAGATACTAGAAACATCTGTCAAGTTAATTGTATTTCTA
CTTATTGAGTTTTTCTAATGTATCGCTGCCCTTGATTCTT
back to top