DC900214

Overview
NameDC900214
Unique NameDC900214
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length578
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900214_ssr416 microsatellite DC900214_ssr416:416..427. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4248 contig Csv1_Contig4248:245..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: MFT_ARATH (Protein MOTHER of FT and TF 1 OS=Arabidopsis thaliana GN=MFT PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 6.502e-47
Identity = 85/104 (81.73%), Postives = 97/104 (93.27%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGL-VEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PDAPSPSEP MREWVHWIVVDIPGGTNP++G EILPYM PRPPVGIHRYI+VLF+Q +P+GL V+QPP+RANF+TR+FAG+ DLGLPVAT+YFN QKEPASRRR
Sbjct:   70 PDAPSPSEPNMREWVHWIVVDIPGGTNPSRGKEILPYMEPRPPVGIHRYILVLFRQNSPVGLMVQQPPSRANFSTRMFAGHFDLGLPVATVYFNAQKEPASRRR 173          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: CEN_ARATH (Protein CENTRORADIALIS-like OS=Arabidopsis thaliana GN=CEN PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 9.761e-27
Identity = 56/103 (54.37%), Postives = 72/103 (69.90%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PD P PS+P +RE +HWIV DIPG T+ + G EI+ Y  PRP +GIHR++ +LF+Q     +V  P  R  FNTR FA   DLGLPVA ++FNCQ+E A+RRR
Sbjct:   73 PDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEIIGYEMPRPNIGIHRFVYLLFKQTRRGSVVSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR 175          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: CET2_TOBAC (CEN-like protein 2 OS=Nicotiana tabacum GN=CET2 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 4.844e-26
Identity = 54/103 (52.43%), Postives = 73/103 (70.87%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PD P PS+P +RE +HWIV DIPG T+ + G EI+ Y  PRP +GIHR++ +LF+QK    ++  P +R  FNTR FA   +LG PVA ++FNCQ+E A+RRR
Sbjct:   73 PDVPGPSDPYLREHLHWIVTDIPGTTDCSFGKEIVGYEMPRPNIGIHRFVFLLFKQKKRQTVLTAPLSRDRFNTRKFAEENELGSPVAAVFFNCQRETAARRR 175          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: CET4_TOBAC (CEN-like protein 4 OS=Nicotiana tabacum GN=CET4 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.079e-25
Identity = 54/103 (52.43%), Postives = 72/103 (69.90%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PD P PS+P +RE +HWIV DIPG T+ + G EI+ Y  PRP +GIHR++ +LF+QK    L+  P +R  FNTR F+   +LG PVA  +FNCQ+E A+RRR
Sbjct:   73 PDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREIVGYEMPRPNIGIHRFVFLLFKQKKRQTLLSAPLSRDRFNTRKFSEENELGSPVAAAFFNCQRETAARRR 175          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: CEN_ANTMA (Protein CENTRORADIALIS OS=Antirrhinum majus GN=CEN PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.841e-25
Identity = 54/105 (51.43%), Postives = 72/105 (68.57%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPT--RANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PD P PS+P +RE +HWIV DIPG T+ + G E++ Y  PRP +GIHR++ +LF+QK     +  PP   R  FNTR F    +LGLPVA ++FNCQ+E A+RRR
Sbjct:   77 PDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFVFLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR 181          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: TFL1_ARATH (Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana GN=TFL1 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.404e-25
Identity = 52/103 (50.49%), Postives = 72/103 (69.90%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PD P PS+P ++E +HWIV +IPG T+   G E++ Y  PRP +GIHR++ VLF+QK    +    P+R +FNTR FA   DLGLPVA ++FN Q+E A+R+R
Sbjct:   75 PDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIGIHRFVFVLFRQKQRRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAARKR 177          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: BFT_ARATH (Protein BROTHER of FT and TFL 1 OS=Arabidopsis thaliana GN=BFT PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 5.356e-25
Identity = 53/103 (51.46%), Postives = 67/103 (65.05%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PDAPSPS P MRE++HW+V DIPG T+ + G EI+ Y  P+P  GIHRY+  LF+Q+    +   P TR  FNT  F+    L  PVA +YFN Q+E A RRR
Sbjct:   72 PDAPSPSNPYMREYLHWMVTDIPGTTDASFGREIVRYETPKPVAGIHRYVFALFKQRGRQAVKAAPETRECFNTNAFSSYFGLSQPVAAVYFNAQRETAPRRR 174          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: SELFP_SOLLC (Protein SELF-PRUNING OS=Solanum lycopersicum GN=SP PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.558e-24
Identity = 50/103 (48.54%), Postives = 72/103 (69.90%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PD P PS+P +RE +HWIV DIPG T+ + G E++ Y  PRP +GIHR++ +LF+QK    +   P +R  F++R F+   +LG PVA ++FNCQ+E A+RRR
Sbjct:   73 PDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREVVGYEMPRPNIGIHRFVFLLFKQKKRQTISSAPVSRDQFSSRKFSEENELGSPVAAVFFNCQRETAARRR 175          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: CET1_TOBAC (CEN-like protein 1 OS=Nicotiana tabacum GN=CET1 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 4.534e-24
Identity = 51/103 (49.51%), Postives = 70/103 (67.96%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLGLVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR 310
            PD P PS+P +RE +HWIV DIPG T+ + G EI+ Y  P+P +GIHRY+++L++Q      V+   TR +FNTR +     LG PVA +YFN Q+E A+RRR
Sbjct:   73 PDVPGPSDPYLREHLHWIVTDIPGSTDSSFGREIVSYESPKPVIGIHRYVLLLYKQSG-RQTVKPAATRDHFNTRRYTAENGLGSPVAAVYFNAQRETAARRR 174          
BLAST of DC900214 vs. ExPASy Swiss-Prot
Match: TSF_ARATH (Protein TWIN SISTER of FT OS=Arabidopsis thaliana GN=TSF PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 6.547e-23
Identity = 55/99 (55.56%), Postives = 65/99 (65.66%), Query Frame = 2
Query:    2 PDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMVLFQQKAPLG--LVEQPPTRANFNTRLFAGNLDLGLPVATIYFNCQKE 292
            PD PSPS P  RE++HW+V DIP  T  A G E++ Y  PRPP GIHR ++VLF+Q   LG   V  P  R  FNTR FA   +LGLPVA  YFNCQ+E
Sbjct:   72 PDVPSPSNPHQREYLHWLVTDIPATTGNAFGNEVVCYESPRPPSGIHRIVLVLFRQ---LGRQTVYAPGWRQQFNTREFAEIYNLGLPVAASYFNCQRE 167          
The following BLAST results are available for this feature:
BLAST of DC900214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
MFT_ARATH6.502e-4781.73Protein MOTHER of FT and TF 1 OS=Arabidopsis thali... [more]
CEN_ARATH9.761e-2754.37Protein CENTRORADIALIS-like OS=Arabidopsis thalian... [more]
CET2_TOBAC4.844e-2652.43CEN-like protein 2 OS=Nicotiana tabacum GN=CET2 PE... [more]
CET4_TOBAC1.079e-2552.43CEN-like protein 4 OS=Nicotiana tabacum GN=CET4 PE... [more]
CEN_ANTMA1.841e-2551.43Protein CENTRORADIALIS OS=Antirrhinum majus GN=CEN... [more]
TFL1_ARATH2.404e-2550.49Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana ... [more]
BFT_ARATH5.356e-2551.46Protein BROTHER of FT and TFL 1 OS=Arabidopsis tha... [more]
SELFP_SOLLC1.558e-2448.54Protein SELF-PRUNING OS=Solanum lycopersicum GN=SP... [more]
CET1_TOBAC4.534e-2449.51CEN-like protein 1 OS=Nicotiana tabacum GN=CET1 PE... [more]
TSF_ARATH6.547e-2355.56Protein TWIN SISTER of FT OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900214 VSS Citrus sinensis cDNA clone VS28250 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900214 ID=DC900214|Name=DC900214|organism=Citrus sinensis|type=EST|length=578bp
TCCTGATGCTCCGAGTCCAAGCGAGCCACGCATGAGGGAGTGGGTTCACT
GGATCGTCGTGGACATTCCTGGTGGCACTAACCCCGCTCAAGGGATGGAG
ATTCTGCCGTACATGGGGCCACGGCCACCGGTGGGGATTCATCGATACAT
AATGGTGCTGTTTCAGCAGAAGGCTCCATTGGGGCTGGTCGAGCAGCCAC
CAACGAGGGCTAACTTCAACACTCGGCTCTTTGCTGGGAATCTGGATCTT
GGCCTCCCTGTGGCCACTATTTACTTCAACTGTCAGAAGGAACCGGCAAG
CCGCAGGCGTTGAACAATCAAGGAGGCGCTAGCTAGTGCTCAGCTCAAGT
GTAATAGACAAAGAGAGTTGTGGTGTCTTTAATATGTTTCTCTTTTGGTT
TTGGTTTTCCTTTTCCTTTCTTTCTTTTTTTTTCCCCGCAAGTGTACTGT
CTCGTTTTAGTCTTAGCATGTAGGTGTTGGCTTTGTTTAATCAGGCTAAA
GTTCATGTAATGTAAGCTGTTTCCCTTGTAATAAGCTTTCGTTTCAATAG
AAAAAAAAATCTGTTTTGTCTGTTTTTC
back to top