DC900211

Overview
NameDC900211
Unique NameDC900211
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length616
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900211_ssr73 microsatellite DC900211_ssr73:73..84. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5644 contig Csv1_Contig5644:1..616. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL222_ARATH (60S ribosomal protein L22-2 OS=Arabidopsis thaliana GN=RPL22B PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.316e-40
Identity = 81/108 (75.00%), Postives = 90/108 (83.33%), Query Frame = 2
Query:  113 TFVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDSVTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            +F IDC KPV+DKIM+IASLEKFLQERIKVGGKAGALGDSVT+TREK+KITVT+D  FS              HNVRDWLRVIA+NKDR++YELRYFNIAENEGEEED
Sbjct:   17 SFTIDCSKPVDDKIMEIASLEKFLQERIKVGGKAGALGDSVTITREKSKITVTADGQFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIAENEGEEED 124          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL223_ARATH (60S ribosomal protein L22-3 OS=Arabidopsis thaliana GN=RPL22C PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.345e-39
Identity = 79/108 (73.15%), Postives = 89/108 (82.41%), Query Frame = 2
Query:  113 TFVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDSVTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            +F IDC KPV+DKIM+IASLEKFLQERIKVGGKAGALGDSV++TREK+KITVT+D  FS              HNVRDWLRVIA+NKDR++YELRYFNIAENE EEED
Sbjct:   17 SFTIDCSKPVDDKIMEIASLEKFLQERIKVGGKAGALGDSVSITREKSKITVTADGQFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIAENEAEEED 124          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL221_ARATH (Putative 60S ribosomal protein L22-1 OS=Arabidopsis thaliana GN=RPL22A PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.656e-28
Identity = 62/108 (57.41%), Postives = 79/108 (73.15%), Query Frame = 2
Query:  113 TFVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDSVTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            +FVIDC KPV+D I++IA+LEKFLQERIKV GKAGALG+SV++TR   KI V ++SNFS              +N+RDWLRVIASNKD++VYE+RYF I +     E+
Sbjct:   19 SFVIDCSKPVDDTILEIATLEKFLQERIKVRGKAGALGNSVSITRYNGKINVNANSNFSKRYLKYLTKKYLKKYNLRDWLRVIASNKDKNVYEVRYFRIDDEVASYEE 126          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL22_RAT (60S ribosomal protein L22 OS=Rattus norvegicus GN=Rpl22 PE=2 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 1.508e-23
Identity = 59/108 (54.63%), Postives = 73/108 (67.59%), Query Frame = 2
Query:  116 FVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDS-VTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            F +DC  PVED IMD A+ E+FLQERIKV GKAG LG   VT+ R K+KITVTS+  FS              +N+RDWLRV+A++K+   YELRYF I ++E EEED
Sbjct:   21 FTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEEPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKES--YELRYFQINQDEEEEED 126          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL22_PIG (60S ribosomal protein L22 OS=Sus scrofa GN=RPL22 PE=2 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 2.573e-23
Identity = 59/108 (54.63%), Postives = 73/108 (67.59%), Query Frame = 2
Query:  116 FVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDS-VTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            F +DC  PVED IMD A+ E+FLQERIKV GKAG LG   VT+ R K+KITVTS+  FS              +N+RDWLRV+A++K+   YELRYF I ++E EEED
Sbjct:   21 FTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKES--YELRYFQINQDEEEEED 126          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL22_MOUSE (60S ribosomal protein L22 OS=Mus musculus GN=Rpl22 PE=2 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 2.573e-23
Identity = 59/108 (54.63%), Postives = 73/108 (67.59%), Query Frame = 2
Query:  116 FVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDS-VTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            F +DC  PVED IMD A+ E+FLQERIKV GKAG LG   VT+ R K+KITVTS+  FS              +N+RDWLRV+A++K+   YELRYF I ++E EEED
Sbjct:   21 FTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKES--YELRYFQINQDEEEEED 126          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL22_MACFA (60S ribosomal protein L22 OS=Macaca fascicularis GN=RPL22 PE=2 SV=3)

HSP 1 Score: 108.612 bits (270), Expect = 2.573e-23
Identity = 59/108 (54.63%), Postives = 73/108 (67.59%), Query Frame = 2
Query:  116 FVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDS-VTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            F +DC  PVED IMD A+ E+FLQERIKV GKAG LG   VT+ R K+KITVTS+  FS              +N+RDWLRV+A++K+   YELRYF I ++E EEED
Sbjct:   21 FTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKES--YELRYFQINQDEEEEED 126          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL22_HUMAN (60S ribosomal protein L22 OS=Homo sapiens GN=RPL22 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 2.573e-23
Identity = 59/108 (54.63%), Postives = 73/108 (67.59%), Query Frame = 2
Query:  116 FVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDS-VTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            F +DC  PVED IMD A+ E+FLQERIKV GKAG LG   VT+ R K+KITVTS+  FS              +N+RDWLRV+A++K+   YELRYF I ++E EEED
Sbjct:   21 FTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKES--YELRYFQINQDEEEEED 126          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL22_ICTPU (60S ribosomal protein L22 OS=Ictalurus punctatus GN=rpl22 PE=2 SV=3)

HSP 1 Score: 108.227 bits (269), Expect = 3.360e-23
Identity = 59/108 (54.63%), Postives = 72/108 (66.67%), Query Frame = 2
Query:  116 FVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDS-VTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            F +DC  PVED IMD A+ E+FLQERIKV GKAG LG   V++ R K+KITVTSD  FS              +N+RDWLRV+A+ K+   YELRYF I ++E EEED
Sbjct:   21 FTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSIERSKSKITVTSDIPFSKRYLKYLTKKYLKKNNLRDWLRVVANTKES--YELRYFQINQDEEEEED 126          
BLAST of DC900211 vs. ExPASy Swiss-Prot
Match: RL22_CHICK (60S ribosomal protein L22 OS=Gallus gallus GN=RPL22 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 7.486e-23
Identity = 58/108 (53.70%), Postives = 73/108 (67.59%), Query Frame = 2
Query:  116 FVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDS-VTVTREKTKITVTSDSNFSXXXXXXXXXXXXXXHNVRDWLRVIASNKDRSVYELRYFNIAENEGEEED 436
            F +DC  PVED IMD A+ E+FLQERIKV GKAG LG   VT+ R K+KITVTS+  FS              +N+RDWLRV+A++K+   YELRYF I ++E EEE+
Sbjct:   21 FTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKES--YELRYFQINQDEEEEEE 126          
The following BLAST results are available for this feature:
BLAST of DC900211 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
RL222_ARATH2.316e-4075.0060S ribosomal protein L22-2 OS=Arabidopsis thalian... [more]
RL223_ARATH3.345e-3973.1560S ribosomal protein L22-3 OS=Arabidopsis thalian... [more]
RL221_ARATH2.656e-2857.41Putative 60S ribosomal protein L22-1 OS=Arabidopsi... [more]
RL22_RAT1.508e-2354.6360S ribosomal protein L22 OS=Rattus norvegicus GN=... [more]
RL22_PIG2.573e-2354.6360S ribosomal protein L22 OS=Sus scrofa GN=RPL22 P... [more]
RL22_MOUSE2.573e-2354.6360S ribosomal protein L22 OS=Mus musculus GN=Rpl22... [more]
RL22_MACFA2.573e-2354.6360S ribosomal protein L22 OS=Macaca fascicularis G... [more]
RL22_HUMAN2.573e-2354.6360S ribosomal protein L22 OS=Homo sapiens GN=RPL22... [more]
RL22_ICTPU3.360e-2354.6360S ribosomal protein L22 OS=Ictalurus punctatus G... [more]
RL22_CHICK7.486e-2353.7060S ribosomal protein L22 OS=Gallus gallus GN=RPL2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900211 VSS Citrus sinensis cDNA clone VS28248 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900211 ID=DC900211|Name=DC900211|organism=Citrus sinensis|type=EST|length=616bp
CTGCAGTGCTCTTCTCCTGTAAATTGTACAATTCGTAGTGCGGCGGAGCA
GAGACGGGAAAATGAGTCGCGGAGCAGCAGCAGCAGGGGTGAAGGGGAAG
AAAAAGGGAGCGACCTTCGTGATAGACTGCGGGAAGCCTGTGGAGGACAA
AATCATGGACATTGCGTCCTTGGAAAAGTTCCTCCAGGAGCGGATCAAGG
TCGGCGGCAAGGCTGGTGCCCTTGGGGATTCAGTTACCGTCACCCGTGAG
AAGACCAAGATCACCGTCACTTCTGACAGCAACTTCTCTAAGAGGTATCT
TAAATATTTGACCAAGAAGTACTTGAAGAAACACAATGTAAGAGATTGGC
TCCGAGTAATTGCTTCAAACAAGGACCGAAGTGTCTATGAGCTGCGATAC
TTCAACATTGCTGAGAATGAGGGAGAGGAGGAAGACTGAAGATCCATTTC
AGTATTTCCTCATATTATATCTATTCTGATTACTTGTTCTAGCTCTTTTT
TCTTTTTTTCTCCTGCGATCAAATCTGTGGACTTGTTTGAATTGTTTATG
AGATCATTCTTAGTTTATGTTCTGNTGAAATTTTGNTTACTTTTTAGATA
TATGGTTTTTTTTTTT
back to top