CX043414

Overview
NameCX043414
Unique NameCX043414
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length857
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2024 contig Csv1_Contig2024:457..1314. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043414 vs. ExPASy Swiss-Prot
Match: TI10B_ARATH (Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10B PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.867e-24
Identity = 73/192 (38.02%), Postives = 103/192 (53.65%), Query Frame = -1
Query:  291 LFPQQAGFAPKNDTPNMIDSSLNK-------PAPQTAQMTIFYGGQVIVFNDFPADKANEIMQLASNGSSLSHGTAYPPMQLPAQGYNSFAASLPKSPVESTPPVSPGPPKIPTEPSCSVPPRSNSIPNFGNNLIPERAQPPSRPCDLPIARRNSLHRFLEKRKDRIVARAPYQVNGSAGAPDKPADSKSWL 845
            +FP+Q+ F+  + +    D  + K       P  Q+A +TIFYGG+V+VF+DF A+KA E++ LA+ GS+ S           A+  N+ +A   K    S     P P   P + +   P + N               P S  C+LPIARR SLHRFLEKRKDRI ++APYQ++GSA A  KP  + +WL
Sbjct:   82 MFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTC------FTAEVNNNHSAYSQKEIASS-----PNPVCSPAKTAAQEPIQPN---------------PASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASSKPT-NPAWL 246          
BLAST of CX043414 vs. ExPASy Swiss-Prot
Match: TI10A_ARATH (Protein TIFY 10A OS=Arabidopsis thaliana GN=TIFY10A PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 3.184e-24
Identity = 78/201 (38.81%), Postives = 102/201 (50.75%), Query Frame = -1
Query:  276 NLFPQQAGFA------PKNDTPNMIDSSLN-KPAPQTAQMTIFYGGQVIVFNDFPADKANEIMQLASNGSSLSHGTAYPPMQLPAQGYNSFAASLPKSPVESTPPVSPGPPKIPTEPSCSVPPRSNSIPNFGNNLIPERAQPPSRP-CDLPIARRNSLHRFLEKRKDRIVARAPYQVNGSAGAPDKP--ADSKSWLGLAAQ 848
            NLFP+Q  F+      PK D   M  ++ + KP  QTA +TIFY GQVIVFNDF A+KA E++ LAS G++                 NS A                   K  T+   ++   +N +P+       E  Q    P  +LPIARR SLHRFLEKRKDR+ ++APYQ+   A A   P    + SWLGLAA+
Sbjct:   88 NLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTA-----------------NSLA-------------------KNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAE 252          
The following BLAST results are available for this feature:
BLAST of CX043414 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
TI10B_ARATH1.867e-2438.02Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10... [more]
TI10A_ARATH3.184e-2438.81Protein TIFY 10A OS=Arabidopsis thaliana GN=TIFY10... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10H09_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10H09-P18-1-7.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043414 ID=CX043414; Name=CX043414; organism=Citrus sinensis; type=EST; length=857bp
TTTTTTTTTTTTTTTTTATTGACTGAAGAAAGAGTCAACACTTAGAATTA
TTCATTGGGATAACATTAACTAAATTTTCAATAAAGAAGTTAATTACATA
AACTATTGGTAAGAAGAATGATCGTCAGATCTATGGTGGGCTCATCAAAA
CCCAACCTAAAAGAAGATGGAAGATGAAGAAAAACAAAGCAAGGTTTATG
TTTGCCAAAAAGACGATGACCGGCCAATAATCAGTCCCTAAAACTGGATG
CAATTTGCACAAACTACTGTGAAGTTTGAGCGGCCAGGCCAAGCCATGAC
TTACTATCAGCAGGCTTGTCTGGAGCCCCTGCTGAGCCATTCACTTGGTA
CGGTGCTCTTGCAACAATCCTGTCTTTTCTCTTCTCCAAGAACCTGTGGA
GTGAATTTCTCCTTGCAATTGGTAGATCACAAGGTCTCGAGGGAGGTTGA
GCGCGTTCTGGAATTAGATTGTTGCCAAAGTTAGGAATGCTATTTGATCG
AGGAGGAACCGAGCAACTAGGCTCTGTTGGAATTTTTGGGGGGCCAGGAG
AAACCGGGGGAGTTGATTCAACTGGACTTTTGGGTAAACTAGCAGCAAAA
GAGTTGTAACCCTGGGCCGGCAGTTGCATAGGAGGATAAGCGGTACCATG
GCTCAGTGAGCTCCCGTTGCTTGCTAATTGCATGATTTCATTTGCTTTAT
CAGCAGGAAAATCATTGAACACAATCACTTGTCCGCCATAAAATATAGTC
ATTTGAGCAGTTTGCGGAGCGGGCTTGTTTAAACTTGAATCTATCATGTT
AGGGGTATCATTCTTAGGAGCAAAACCAGCTTGTTGAGGGAACAAATTCA
TTGATTC
back to top