DC900206

Overview
NameDC900206
Unique NameDC900206
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length577
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: SF3B3_PONAB (Splicing factor 3B subunit 3 OS=Pongo abelii GN=SF3B3 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.386e-41
Identity = 72/125 (57.60%), Postives = 101/125 (80.80%), Query Frame = 3
Query:    6 EEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            E I+ +HVG+ V SLQK +L+PGG ES++Y T+ G +G ++ F+S +D DFF H+EMH+R EHPPLCGRDH+++RS YFPVK+VIDGDLCEQF ++  + Q+ +++ELDRTP E+ KKLE+IR +
Sbjct: 1090 EVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVTKKLEDIRTR 1214          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: SF3B3_MOUSE (Splicing factor 3B subunit 3 OS=Mus musculus GN=Sf3b3 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.810e-41
Identity = 72/125 (57.60%), Postives = 101/125 (80.80%), Query Frame = 3
Query:    6 EEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            E I+ +HVG+ V SLQK +L+PGG ES++Y T+ G +G ++ F+S +D DFF H+EMH+R EHPPLCGRDH+++RS YFPVK+VIDGDLCEQF ++  + Q+ +++ELDRTP E+ KKLE+IR +
Sbjct: 1090 EVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTR 1214          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: SF3B3_HUMAN (Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4)

HSP 1 Score: 168.703 bits (426), Expect = 1.810e-41
Identity = 72/125 (57.60%), Postives = 101/125 (80.80%), Query Frame = 3
Query:    6 EEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            E I+ +HVG+ V SLQK +L+PGG ES++Y T+ G +G ++ F+S +D DFF H+EMH+R EHPPLCGRDH+++RS YFPVK+VIDGDLCEQF ++  + Q+ +++ELDRTP E+ KKLE+IR +
Sbjct: 1090 EVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTR 1214          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: SF3B3_BOVIN (Splicing factor 3B subunit 3 OS=Bos taurus GN=SF3B3 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.810e-41
Identity = 72/125 (57.60%), Postives = 101/125 (80.80%), Query Frame = 3
Query:    6 EEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            E I+ +HVG+ V SLQK +L+PGG ES++Y T+ G +G ++ F+S +D DFF H+EMH+R EHPPLCGRDH+++RS YFPVK+VIDGDLCEQF ++  + Q+ +++ELDRTP E+ KKLE+IR +
Sbjct: 1090 EVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTR 1214          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: SF3B3_DANRE (Splicing factor 3B subunit 3 OS=Danio rerio GN=sf3b3 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 6.877e-41
Identity = 72/125 (57.60%), Postives = 99/125 (79.20%), Query Frame = 3
Query:    6 EEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            E I+ +H+G+ V SLQK +L+PGG ES++Y T+ G +G ++ F+S +D DFF HLEMHMR E PPLCGRDH+++RS YFPVK+VIDGDLCEQF ++    Q+ +++ELDRTP E+ KKLE+IR +
Sbjct: 1090 EIIINYHIGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHLEMHMRSEFPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMDPHKQKSVSEELDRTPPEVSKKLEDIRTR 1214          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: SF3B3_DICDI (Probable splicing factor 3B subunit 3 OS=Dictyostelium discoideum GN=sf3b3 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 9.930e-40
Identity = 75/126 (59.52%), Postives = 100/126 (79.37%), Query Frame = 3
Query:    3 MEEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            ++ I  F VGD VT+L K SLV GG E ++Y T+ G++GA++ F+SR+DVDFFS LEM+MR +  PLCGRDH+AYRS YFPVK++IDGDLCEQF TL+   Q  I++EL R+P E++KKLEEIR++
Sbjct: 1128 LDHIANFFVGDTVTTLNKTSLVVGGPEVILYTTISGAIGALIPFTSREDVDFFSTLEMNMRSDCLPLCGRDHLAYRSYYFPVKNIIDGDLCEQFSTLNYQKQLSISEELSRSPSEVIKKLEEIRSQ 1253          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_USTMA (Pre-mRNA-splicing factor RSE1 OS=Ustilago maydis GN=RSE1 PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.300e-31
Identity = 66/121 (54.55%), Postives = 87/121 (71.90%), Query Frame = 3
Query:   12 IVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIR 374
            +  F VGD++TSL + ++V GG E ++Y  + GS+GA++ F S++DVD  S LE H+RQE+  + GRDH+AYRS+Y PVK VIDGDLCE F  LS   Q  IA ELDR PGEI KKL ++R
Sbjct: 1095 VAHFFVGDIITSLHRTAMVAGGREVLLYTGLSGSIGALVPFVSKEDVDTLSTLESHLRQENNSIVGRDHLAYRSSYAPVKSVIDGDLCETFGLLSPAKQNAIAGELDRKPGEINKKLAQLR 1215          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_CRYNE (Pre-mRNA-splicing factor RSE1 OS=Cryptococcus neoformans GN=RSE1 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 5.462e-30
Identity = 62/123 (50.41%), Postives = 87/123 (70.73%), Query Frame = 3
Query:    6 EEIVQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIR 374
            E I  +++G VVTS+ K  LV GG + ++Y T+ G++GA++ F S DD++F S LEMHMR +   L GRDH+AYR  Y P+K V+DGDLCE F  L    Q+ IA +LDR+ G++LKKLE++R
Sbjct: 1090 EMIGHYNIGSVVTSITKIPLVAGGRDVLVYTTISGAVGALVPFVSSDDIEFMSTLEMHMRTQDISLVGRDHIAYRGYYVPIKGVVDGDLCESFSLLPYPKQQAIALDLDRSVGDVLKKLEQMR 1212          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_NEUCR (Pre-mRNA-splicing factor rse-1 OS=Neurospora crassa GN=rse-1 PE=3 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 4.623e-29
Identity = 62/122 (50.82%), Postives = 84/122 (68.85%), Query Frame = 3
Query:   15 VQFHVGDVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            V F+  D+ TS+ K SLV GG + +++  + G++G  + F SR+DVDFF +LE HMR E PPL GRDH+ YR  Y PVK VIDGDLCE+F  L  D ++ IA ELDR+  EI +K+ +IR +
Sbjct: 1085 VHFYTQDLPTSICKTSLVVGGQDVLLWSGLQGTVGVFIPFVSREDVDFFQNLENHMRAEDPPLAGRDHLIYRGYYTPVKGVIDGDLCERFSLLPNDKKQMIAGELDRSVREIERKISDIRTR 1206          
BLAST of DC900206 vs. ExPASy Swiss-Prot
Match: RSE1_MAGGR (Pre-mRNA-splicing factor RSE1 OS=Magnaporthe grisea GN=RSE1 PE=3 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 2.997e-28
Identity = 58/116 (50.00%), Postives = 80/116 (68.97%), Query Frame = 3
Query:   33 DVVTSLQKASLVPGGGESVIYGTVMGSLGAMLAFSSRDDVDFFSHLEMHMRQEHPPLCGRDHMAYRSAYFPVKDVIDGDLCEQFPTLSLDLQRKIADELDRTPGEILKKLEEIRNK 380
            D+ TS+ K +LV GG E +++G   G++G ++ F SR+D DFF  LE H+R E PPL GRDH+ YR  Y PVK VIDGDLCE++  L  D ++ IA ELDR+  EI +K+ +IR +
Sbjct: 1098 DIPTSICKTNLVVGGQEVLLWGGFQGTIGVLIPFVSREDADFFQSLEQHLRSEDPPLAGRDHLMYRGCYVPVKGVIDGDLCERYTMLPNDKKQMIAGELDRSVREIERKISDIRTR 1213          
The following BLAST results are available for this feature:
BLAST of DC900206 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
SF3B3_PONAB1.386e-4157.60Splicing factor 3B subunit 3 OS=Pongo abelii GN=SF... [more]
SF3B3_MOUSE1.810e-4157.60Splicing factor 3B subunit 3 OS=Mus musculus GN=Sf... [more]
SF3B3_HUMAN1.810e-4157.60Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF... [more]
SF3B3_BOVIN1.810e-4157.60Splicing factor 3B subunit 3 OS=Bos taurus GN=SF3B... [more]
SF3B3_DANRE6.877e-4157.60Splicing factor 3B subunit 3 OS=Danio rerio GN=sf3... [more]
SF3B3_DICDI9.930e-4059.52Probable splicing factor 3B subunit 3 OS=Dictyoste... [more]
RSE1_USTMA1.300e-3154.55Pre-mRNA-splicing factor RSE1 OS=Ustilago maydis G... [more]
RSE1_CRYNE5.462e-3050.41Pre-mRNA-splicing factor RSE1 OS=Cryptococcus neof... [more]
RSE1_NEUCR4.623e-2950.82Pre-mRNA-splicing factor rse-1 OS=Neurospora crass... [more]
RSE1_MAGGR2.997e-2850.00Pre-mRNA-splicing factor RSE1 OS=Magnaporthe grise... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900206 VSS Citrus sinensis cDNA clone VS28243 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900206 ID=DC900206|Name=DC900206|organism=Citrus sinensis|type=EST|length=577bp
AGATGGAGGAGATAGTACAGTTTCATGTTGGTGATGTGGTCACATCCTTG
CAGAAGGCATCCCTGGTTCCAGGTGGCGGGGAGAGTGTCATTTATGGAAC
AGTGATGGGTAGCTTGGGAGCTATGCTTGCATTTTCATCCCGTGATGATG
TTGACTTCTTTTCTCACCTTGAGATGCATATGAGGCAGGAACATCCACCT
TTATGTGGTCGTGATCACATGGCTTACAGATCAGCTTATTTCCCTGTTAA
GGACGTGATTGATGGGGATCTATGTGAGCAGTTCCCAACCCTGTCTTTAG
ATTTGCAAAGAAAAATTGCCGATGAATTGGATAGGACTCCTGGAGAGATC
CTCAAGAAACTTGAAGAAATCAGAAACAAGATCGTTTGAGAGAAGAAGAA
ACTATTTGGATGTAGCGTTTATTGTTGTTATTTTATTTGTTGTATATACG
GGCAGCAATCTTGTGATTTGCTAAAGTAGGATTTTAGCTTGTATTGTTGA
AATTTTTCTCAGTGTTCCTCTGTACTGCTACTTGGTACTCTTAACTAATG
CCGGAACCTGTTCAAGTGTCCTTCCTT
back to top