DC900205

Overview
NameDC900205
Unique NameDC900205
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length760
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13796 contig Csv1_Contig13796:503..1262. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER42_ARATH (Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=1 SV=2)

HSP 1 Score: 331.643 bits (849), Expect = 2.750e-90
Identity = 156/181 (86.19%), Postives = 169/181 (93.37%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLANKLH 545
            GRRDG KSR ++LE YLPDHN+S+SVVLE+F +IGID PGLVALLGSHSVGRTHCVKLVHRLYPEVDP+LNPDHVPHMLHKCPD+IPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGL++VDHQLA DKRTRP VKKMAK Q YFFKEF+RAI +LSENNPLTG+KGEIRK CNLANK H
Sbjct:  150 GRRDGLKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHRLYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLLLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLANKNH 330          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER21_ARATH (Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=1 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.684e-55
Identity = 101/178 (56.74%), Postives = 128/178 (71.91%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 536
            GRRD R S    +E  +P+HNDS+S V+  F +IGID    VALLG+HSVGR HCV LVHRLYP +DP L+P +  ++  +CP   PDP AV Y RNDR TPMV+DN YY+NI+ +KGL+++D +LATD RT P+V KMA   +YF ++FSR + LLSE NPLTG +GEIRK C   N
Sbjct:  150 GRRDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCVNLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAVLYSRNDRETPMVVDNMYYKNIMAHKGLLVIDDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGDQGEIRKDCRYVN 327          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER63_ARATH (Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.659e-26
Identity = 63/178 (35.39%), Postives = 101/178 (56.74%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 536
            GRRD R S++ ++   LP  +  +S ++++F++ G     +VAL G+H++G +HC +  +R+ P      NP     +   C ++  DP    +  ND  TP   DN Y++NI    GL+  DH L +D RTRP+V+  A+ Q  FF +F+ A+  LS +  LTG +GEIR+ C+  N
Sbjct:  153 GRRDSRTSKSSLVSDLLPLPSMQISKLIDQFSSRGFSVQEMVALSGAHTIGFSHCKEFTNRVNPNNSTGYNPRFAVALKKACSNSKNDPTISVF--NDVMTPNKFDNMYFQNIPKGLGLLESDHGLFSDPRTRPFVELYARDQSRFFNDFAGAMQKLSLHGVLTGRRGEIRRRCDAIN 328          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER31_ARATH (Peroxidase 31 OS=Arabidopsis thaliana GN=PER31 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.537e-24
Identity = 66/178 (37.08%), Postives = 99/178 (55.62%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 536
            GRRD R S++ +L   LP  +  +S ++++F + G     +VAL G+HS+G +HC + V R+    +   NP     +   C +   DP    +  ND  TP   DN YY+N+    GL+  DH L +D RTR +V   AK+QD FFK+F++A+  LS     TG +GEIR+ C+  N
Sbjct:  142 GRRDSRTSKSSLLTDLLPLPSTPISKIIQQFESKGFTVQEMVALSGAHSIGFSHCKEFVGRVGRN-NTGYNPRFAVALKKACANYPKDPTISVF--NDIMTPNKFDNMYYQNLKKGLGLLESDHGLYSDPRTRYFVDLYAKNQDLFFKDFAKAMQKLSLFGIQTGRRGEIRRRCDAIN 316          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER41_ARATH (Peroxidase 41 OS=Arabidopsis thaliana GN=PER41 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.879e-22
Identity = 62/181 (34.25%), Postives = 97/181 (53.59%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLANKLH 545
            GR+DG +S+A  ++  LP  N S+  +L  F   G     LVAL G H++G +HC +  +R++P+VDP LN      +   C +   +     ++  D  TP   DN Y++N+    GL+  DH L  D  TRP+V+  A +Q  FF++F+RA+  L          GE+R+ C+  NKL+
Sbjct:  147 GRKDGFESKAHKVKGNLPLANQSVPDMLSIFKKNGFTLKELVALSGGHTIGFSHCKEFSNRIFPKVDPELNAKFAGVLKDLCKNFETNKTMAAFL--DPVTPGKFDNMYFKNLKRGLGLLASDHILFKDPSTRPFVELYANNQTAFFEDFARAMEKLGRVGVKGEKDGEVRRRCDHFNKLN 325          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER45_ARATH (Peroxidase 45 OS=Arabidopsis thaliana GN=PER45 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.205e-22
Identity = 61/183 (33.33%), Postives = 93/183 (50.82%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 536
            GRRDGR S    ++  LP    +++ +   F+  G+    ++AL G+H++G  HC K+  R+Y       +DP++N  +V  +   CP  +    A+     D  +P   DN Y++N+   KGL   D  L TD+R+R  V   A S+  F + F  AIT L     LTG  GEIR+ C+  N
Sbjct:  146 GRRDGRISTKASVQSQLPQPEFNLNQLNGMFSRHGLSQTDMIALSGAHTIGFAHCGKMSKRIYNFSPTTRIDPSINRGYVVQLKQMCPIGVDVRIAINM---DPTSPRTFDNAYFKNLQQGKGLFTSDQILFTDQRSRSTVNSFANSEGAFRQAFITAITKLGRVGVLTGNAGEIRRDCSRVN 325          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER36_ARATH (Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 3.205e-22
Identity = 63/188 (33.51%), Postives = 98/188 (52.13%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDK-RTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLANKLHD 548
            GRRD R++      + +P    ++  +L  F   G+D   LVALLGSH++G + C+    RLY      + D  LN D+   +   CP +  D         D  TP   DN YY+N+++ +GL+  D  L T    T   VK  A+++  FF++F++++  +   +PLTGT GEIR++C   N  HD
Sbjct:  161 GRRDAREASLIGSMENIPSPESTLQTILTMFNFQGLDLTDLVALLGSHTIGNSRCIGFRQRLYNHTGNNDPDQTLNQDYASMLQQGCPISGNDQNLFNL---DYVTPTKFDNYYYKNLVNFRGLLSSDEILFTQSIETMEMVKYYAENEGAFFEQFAKSMVKMGNISPLTGTDGEIRRICRRVN--HD 343          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER51_ARATH (Peroxidase 51 OS=Arabidopsis thaliana GN=PER51 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 5.467e-22
Identity = 63/183 (34.43%), Postives = 90/183 (49.18%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP-----EVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 536
            GRRDG  S A  +   LP     ++ +   FA  G+    ++AL G+H++G  HC K+ +RLY       VDP +N D+V  +   CP  I DP+    +  D  TP   DN YY+N+   KGL   D  L TD R++P V   A +   F + F  ++  L      TG+ G IR+ C   N
Sbjct:  150 GRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIALSGAHTLGFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNI-DPRVA--INMDPNTPRQFDNVYYKNLQQGKGLFTSDQVLFTDSRSKPTVDLWANNGQLFNQAFISSMIKLGRVGVKTGSNGNIRRDCGAFN 329          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER50_ARATH (Peroxidase 50 OS=Arabidopsis thaliana GN=PER50 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 5.467e-22
Identity = 62/183 (33.88%), Postives = 92/183 (50.27%), Query Frame = 3
Query:    3 GRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP-----EVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 536
            GR DG  S A  +   LP   D ++ +   FA  G+    ++AL G+H++G  HC K+ +R+Y      +VDP +N D+V  +   CP  I DP+    +  D  TP   DN YY+N+   KGL   D  L TD+R++P V   A +   F + F  ++  L      TG+ G IR+ C   N
Sbjct:  150 GRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGAHTLGFAHCTKVFNRIYTFNKTTKVDPTVNKDYVTELKASCPRNI-DPRVA--INMDPTTPRQFDNVYYKNLQQGKGLFTSDQVLFTDRRSKPTVDLWANNGQLFNQAFINSMIKLGRVGVKTGSNGNIRRDCGAFN 329          
BLAST of DC900205 vs. ExPASy Swiss-Prot
Match: PER12_ARATH (Peroxidase 12 OS=Arabidopsis thaliana GN=PER12 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.218e-21
Identity = 64/179 (35.75%), Postives = 88/179 (49.16%), Query Frame = 3
Query:    3 GRRDGRK-SRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLHKCPDAIPDPKAVQYVRNDRGTPMVLDNNYYRNILDNKGLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 536
            GRRD    +  E     LP    + S ++  FA   ++   LVAL G H++G  HC     RLYP  DP +N      +   CP A      V    ND  +P V DN YY ++++ +GL   D  L  DKRTR  V+  A  Q  FF  F+ A+  + + + LTGT+GEIR  C+  N
Sbjct:  165 GRRDSLAFASQETTLNNLPPPFFNASQLIADFANRNLNITDLVALSGGHTIGIAHCPSFTDRLYPNQDPTMNQFFANSLKRTCPTANSSNTQV----NDIRSPDVFDNKYYVDLMNRQGLFTSDQDLFVDKRTRGIVESFAIDQQLFFDYFTVAMIKMGQMSVLTGTQGEIRSNCSARN 339          
The following BLAST results are available for this feature:
BLAST of DC900205 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER42_ARATH2.750e-9086.19Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=... [more]
PER21_ARATH1.684e-5556.74Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=... [more]
PER63_ARATH3.659e-2635.39Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=... [more]
PER31_ARATH1.537e-2437.08Peroxidase 31 OS=Arabidopsis thaliana GN=PER31 PE=... [more]
PER41_ARATH1.879e-2234.25Peroxidase 41 OS=Arabidopsis thaliana GN=PER41 PE=... [more]
PER45_ARATH3.205e-2233.33Peroxidase 45 OS=Arabidopsis thaliana GN=PER45 PE=... [more]
PER36_ARATH3.205e-2233.51Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=... [more]
PER51_ARATH5.467e-2234.43Peroxidase 51 OS=Arabidopsis thaliana GN=PER51 PE=... [more]
PER50_ARATH5.467e-2233.88Peroxidase 50 OS=Arabidopsis thaliana GN=PER50 PE=... [more]
PER12_ARATH1.218e-2135.75Peroxidase 12 OS=Arabidopsis thaliana GN=PER12 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900205 VSS Citrus sinensis cDNA clone VS28242 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900205 ID=DC900205|Name=DC900205|organism=Citrus sinensis|type=EST|length=760bp
CAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTTGAGCAGTAT
CTCCCAGATCACAATGACAGCATGTCTGTTGTTCTTGAGAGGTTTGCAGC
CATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGATCTCACAGTG
TTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTACCCAGAAGTT
GACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCATAAGTGTCC
TGATGCAATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGAATGACCGTG
GCACACCCATGGTGCTGGACAACAACTACTATAGGAACATATTGGACAAC
AAGGGCTTGATGATGGTTGATCATCAGCTAGCCACCGACAAGAGGACAAG
ACCTTATGTTAAGAAGATGGCCAAGAGTCAAGACTACTTCTTCAAGGAAT
TTTCAAGAGCCATTACTCTCCTTTCTGAGAACAACCCTCTCACAGGTACA
AAGGGTGAGATCCGAAAGGTTTGCAATCTTGCCAACAAGCTCCACGACAA
GTCCTAGCTAGCTAACAGCTGTATTAGCTACAACAAGTTAATAGCTCCAA
ATTTTTCTTCCTTGTTTCTTCTATGAGGAAGAAAAGAGTGTGAGATGAGC
TCCCAATAAGATGTTTTTTCTAGATCGGTTTGTTTCCTGTGAGATGTTCG
TATTACTGCTATTATGTTCCTTAGATGTACCGTCCAATGTTTAAGCCTAG
GCTTTCCTTT
back to top