DC900202

Overview
NameDC900202
Unique NameDC900202
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length688
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9674 contig Csv1_Contig9674:140..827. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900202 vs. ExPASy Swiss-Prot
Match: YJX4_SCHPO (CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe GN=SPCC23B6.04c PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.030e-13
Identity = 45/106 (42.45%), Postives = 62/106 (58.49%), Query Frame = 2
Query:  341 IARHLRAQNWNVKKATKMLKETLKWRAEYKPEEIRWDEIANEAETGKIYRSNYVDKYGRAVLVMRPSCQNTKSTKGQIRYLVYCMENAILNLPPHQEQMVWLIDFQ 658
            I R+LRA  W+V  A K + +TL WR  +    +  DEI  E  TGK     Y DK GR  L + P+ QNTK++  QIR+LV+ +E AI  +PP  E +  LI+F+
Sbjct:  638 ILRYLRATKWHVSNAKKRIVDTLVWRRHFGVNNMDPDEIQEENATGKQVLLGY-DKDGRPCLYLYPARQNTKTSPLQIRHLVFSLECAIDLMPPGVETLALLINFK 742          
BLAST of DC900202 vs. ExPASy Swiss-Prot
Match: RSC5_DICDI (Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.165e-11
Identity = 35/118 (29.66%), Postives = 66/118 (55.93%), Query Frame = 2
Query:  323 YCSDASIARHLRAQNWNVKKATKMLKETLKWRAEYKPEEIRWDEIANEAETGKIYRSNYVDKYGRAVLVMRPSCQNTKSTKGQIRY--LVYCMENAI--LNLPPHQEQMVWLIDFQGF 664
            +C+D    R+LRA+N+ V K+ KML++TL+WR +++P++I+      E  +      N  DK GR ++   P     K+   ++++  LVY +E     ++ P   EQ  +++D++ F
Sbjct:   70 FCTDMCFLRYLRARNYIVSKSEKMLRDTLEWRKKFRPQDIQLGGDIREIGSAGCVYVNKRDKKGRPIIFAVPRNDTLKNVPSELKFKNLVYWLEQGFSRMDEPKGIEQFCFIVDYKDF 187          
The following BLAST results are available for this feature:
BLAST of DC900202 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
YJX4_SCHPO1.030e-1342.45CRAL-TRIO domain-containing protein C23B6.04c OS=S... [more]
RSC5_DICDI8.165e-1129.66Random slug protein 5 OS=Dictyostelium discoideum ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900202 VSS Citrus sinensis cDNA clone VS28239 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900202 ID=DC900202|Name=DC900202|organism=Citrus sinensis|type=EST|length=688bp
GTTTAAGGAGCCCCGAAATAATCGCTCTTGTTTTCTGTTGAGGATCCAAT
TCTCTGTCATTCAGCATGCTTTAATCATCCTGTATAAAGATGAAGATGAG
GAAATACTGAACATTGAGATGGTAACAGCCACTGTTGGCAGTAATACCAA
AGGTGTGAAATTTCCAACTGTTTACCTACTGGGAGACTTGTAAACTATGA
GTGCTGATGCAAATAAATCTACTACAAATGGGTATGAAAAGCCTTTACCA
TCGGAGGAACAGCAAAGAAAGATTAATGAAGTGAGGAGGTTGCTTGGGCT
GTTGTCTGGTAGATTGTCCATTTATTGCTCTGATGCTTCAATCGCAAGGC
ATTTAAGGGCACAAAATTGGAATGTCAAGAAGGCAACTAAAATGCTGAAA
GAAACTCTAAAATGGAGAGCTGAATACAAACCTGAAGAGATTCGTTGGGA
TGAAATTGCTAATGAAGCGGAGACCGGGAAGATATATAGATCGAATTATG
TGGACAAGTATGGGAGAGCAGTTCTCGTCATGAGACCTAGTTGCCAGAAT
ACAAAGTCAACTAAAGGACAAATTAGGTATTTGGTGTATTGCATGGAGAA
TGCAATTCTAAATCTGCCACCTCACCAGGAGCAGATGGTCTGGTTGATTG
ATTTCCAAGGNTTCAATTTATCCCATATTCAGTGAGTA
back to top