DC900201

Overview
NameDC900201
Unique NameDC900201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length804
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5643 contig Csv1_Contig5643:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSEP_RICCO (Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 3.570e-107
Identity = 181/215 (84.19%), Postives = 197/215 (91.63%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYPKDEL 657
            +CGSCWAFSTI AVEGIN I TNKLVSLSEQELVDCDTDQNQGCNGGLM+ AFEFIK++GG+TTEA YPY+A DGTCDVSKE++PAVSIDGHENVP N E+ALLKAVA QPVSVAIDAG SDFQFYSEGVFTG CGTEL+HGVA VGYGTT+DGTKYW V+NSWGPEWGEKGYIRM+RGISDK+GLCGIAMEASYPIKKS+ NP+G    PKDEL
Sbjct:  146 QCGSCWAFSTIVAVEGINQIKTNKLVSLSEQELVDCDTDQNQGCNGGLMDYAFEFIKQRGGITTEANYPYEAYDGTCDVSKENAPAVSIDGHENVPENDENALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGSCGTELDHGVAIVGYGTTIDGTKYWTVKNSWGPEWGEKGYIRMERGISDKEGLCGIAMEASYPIKKSSNNPSGIKSSPKDEL 360          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSEP_PHAVU (Vignain OS=Phaseolus vulgaris PE=2 SV=2)

HSP 1 Score: 364.385 bits (934), Expect = 4.226e-100
Identity = 171/215 (79.53%), Postives = 187/215 (86.98%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYPKDEL 657
            +CGSCWAFST+ AVEGIN I TNKLV+LSEQELVDCD ++NQGCNGGLME AFEFIK+KGG+TTE+ YPY+A +GTCD SK +  AVSIDGHENVPAN EDALLKAVA QPVSVAIDAG SDFQFYSEGVFTG+C T+LNHGVA VGYGTT+DGT YWIVRNSWGPEWGE GYIRMQR IS K+GLCGIAM  SYPIK S+ NPTG    PKDEL
Sbjct:  148 QCGSCWAFSTVVAVEGINQIKTNKLVALSEQELVDCDKEENQGCNGGLMESAFEFIKQKGGITTESNYPYKAQEGTCDASKVNDLAVSIDGHENVPANDEDALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCSTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEHGYIRMQRNISKKEGLCGIAMLPSYPIKNSSDNPTGSFSSPKDEL 362          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSEP_VIGMU (Vignain OS=Vigna mungo PE=1 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 5.520e-100
Identity = 172/215 (80.00%), Postives = 187/215 (86.98%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYPKDEL 657
            +CGSCWAFSTI AVEGIN I TNKLVSLSEQELVDCD ++NQGCNGGLME AFEFIK+KGG+TTE+ YPY A +GTCD SK +  AVSIDGHENVP N E+ALLKAVA QPVSVAIDAG SDFQFYSEGVFTG+C T+LNHGVA VGYGTT+DGT YWIVRNSWGPEWGE+GYIRMQR IS K+GLCGIAM ASYPIK S+ NPTG    PKDEL
Sbjct:  148 QCGSCWAFSTIVAVEGINQIKTNKLVSLSEQELVDCDKEENQGCNGGLMESAFEFIKQKGGITTESNYPYTAQEGTCDESKVNDLAVSIDGHENVPVNDENALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCNTDLNHGVAIVGYGTTVDGTNYWIVRNSWGPEWGEQGYIRMQRNISKKEGLCGIAMMASYPIKNSSDNPTGSLSSPKDEL 362          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP_HEMSP (Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN102 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 3.474e-86
Identity = 155/215 (72.09%), Postives = 177/215 (82.33%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYPKDEL 657
            +CGSCWAFSTIA+VEGIN I T +LVSLSEQELVDCDT  N+GCNGGLM+ AFEFI+K G +TTE  YPY   DGTC  +  +SP VSIDGH++VPAN+E+AL++AVA QP+SV+I+A    FQFYSEGVFTG CGTEL+HGVA VGYG T DGTKYWIV+NSWG EWGE GYIRMQRGISDK+G CGIAMEASYPIK SA NP   S   +DEL
Sbjct:  150 QCGSCWAFSTIASVEGINQIKTGELVSLSEQELVDCDTSYNEGCNGGLMDYAFEFIQKNG-ITTEDSYPYAEQDGTCASNLLNSPVVSIDGHQDVPANNENALMQAVANQPISVSIEASGYGFQFYSEGVFTGRCGTELDHGVAIVGYGATRDGTKYWIVKNSWGEEWGESGYIRMQRGISDKRGKCGIAMEASYPIKTSA-NPKNSS--TRDEL 360          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP2_HORVU (Cysteine proteinase EP-B 2 OS=Hordeum vulgare GN=EPB2 PE=1 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.048e-74
Identity = 134/209 (64.11%), Postives = 160/209 (76.56%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSK--ESSPAV-SIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKK-SATNPT 627
            +CGSCWAFST+ +VEGIN I T  LVSLSEQEL+DCDT  N GC GGLM+ AFE+IK  GG+ TEA YPY+A  GTC+V++  ++SP V  IDGH++VPAN E+ L +AVA QPVSVA++A    F FYSEGVFTGECGTEL+HGVA VGYG   DG  YW V+NSWGP WGE+GYIR+++      GLCGIAMEASYP+K  S   PT
Sbjct:  154 KCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDGCQGGLMDNAFEYIKNNGGLITEAAYPYRAARGTCNVARAAQNSPVVVHIDGHQDVPANSEEDLARAVANQPVSVAVEASGKAFMFYSEGVFTGECGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVKTYSKPKPT 362          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP1_HORVU (Cysteine proteinase EP-B 1 OS=Hordeum vulgare GN=EPB1 PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 3.050e-74
Identity = 130/201 (64.68%), Postives = 157/201 (78.11%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSK--ESSPAV-SIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIK 606
            +CGSCWAFST+ +VEGIN I T  LVSLSEQEL+DCDT  N GC GGLM+ AFE+IK  GG+ TEA YPY+A  GTC+V++  ++SP V  IDGH++VPAN E+ L +AVA QPVSVA++A    F FYSEGVFTG+CGTEL+HGVA VGYG   DG  YW V+NSWGP WGE+GYIR+++      GLCGIAMEASYP+K
Sbjct:  154 KCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDGCQGGLMDNAFEYIKNNGGLITEAAYPYRAARGTCNVARAAQNSPVVVHIDGHQDVPANSEEDLARAVANQPVSVAVEASGKAFMFYSEGVFTGDCGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVK 354          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 276.559 bits (706), Expect = 1.159e-73
Identity = 131/210 (62.38%), Postives = 156/210 (74.29%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYP 645
            CGSCWAFS IAAVEGIN I+T  L+SLSEQELVDCDT  N+GCNGGLM+ AF+FI   GG+ TE  YPY+  D  CDV+++++  V+ID +E+V  N E +L KAVA QPVSVAI+AG   FQ YS G+FTG+CGT L+HGVAAVGYGT  +G  YWIVRNSWG  WGE GY+RM+R I    G CGIA+E SYP+KK   NP  P   P
Sbjct:  150 CGSCWAFSAIAAVEGINQIVTGDLISLSEQELVDCDTSYNEGCNGGLMDYAFDFIINNGGIDTEDDYPYKGKDERCDVNRKNAKVVTIDSYEDVTPNSETSLQKAVANQPVSVAIEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTE-NGKDYWIVRNSWGKSWGESGYVRMERNIKASSGKCGIAVEPSYPLKK-GENPPNPGPTP 357          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: CYSP1_ORYSJ (Cysteine protease 1 OS=Oryza sativa subsp. japonica GN=CP1 PE=2 SV=2)

HSP 1 Score: 274.633 bits (701), Expect = 4.404e-73
Identity = 135/214 (63.08%), Postives = 158/214 (73.83%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD-QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGT-TLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSAT-NPTGPSDYP 645
            +CGSCWAFS +AAVEGIN I+T +LVSLSEQELV+C  + QN GCNGG+M+ AF FI + GG+ TE  YPY A DG C+++K S   VSIDG E+VP N E +L KAVA QPVSVAIDAG  +FQ Y  GVFTG CGT L+HGV AVGYGT    G  YW VRNSWGP+WGE GYIRM+R ++ + G CGIAM ASYPIKK     P+ PS  P
Sbjct:  176 QCGSCWAFSAVAAVEGINKIVTGELVSLSEQELVECARNGQNSGCNGGIMDDAFAFIARNGGLDTEEDYPYTAMDGKCNLAKRSRKVVSIDGFEDVPENDELSLQKAVAHQPVSVAIDAGGREFQLYDSGVFTGRCGTNLDHGVVAVGYGTDAATGAAYWTVRNSWGPDWGENGYIRMERNVTARTGKCGIAMMASYPIKKGPNPKPSPPSPAP 389          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: ORYB_ORYSJ (Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2)

HSP 1 Score: 273.863 bits (699), Expect = 7.512e-73
Identity = 130/212 (61.32%), Postives = 161/212 (75.94%), Query Frame = 1
Query:   13 ECGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTD-QNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYP 645
            +CGSCWAFS ++ VE IN ++T ++++LSEQELV+C T+ QN GCNGGLM+ AF+FI K GG+ TE  YPY+A DG CD+++E++  VSIDG E+VP N E +L KAVA QPVSVAI+AG  +FQ Y  GVF+G CGT L+HGV AVGYGT  +G  YWIVRNSWGP+WGE GY+RM+R I+   G CGIAM ASYP  KS  NP  PS  P
Sbjct:  161 QCGSCWAFSAVSTVESINQLVTGEMITLSEQELVECSTNGQNSGCNGGLMDDAFDFIIKNGGIDTEDDYPYKAVDGKCDINRENAKVVSIDGFEDVPQNDEKSLQKAVAHQPVSVAIEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTD-NGKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMMASYP-TKSGANPPKPSPTP 370          
BLAST of DC900201 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 9.812e-73
Identity = 127/210 (60.48%), Postives = 155/210 (73.81%), Query Frame = 1
Query:   16 CGSCWAFSTIAAVEGINHIMTNKLVSLSEQELVDCDTDQNQGCNGGLMELAFEFIKKKGGVTTEAKYPYQANDGTCDVSKESSPAVSIDGHENVPANHEDALLKAVAKQPVSVAIDAGSSDFQFYSEGVFTGECGTELNHGVAAVGYGTTLDGTKYWIVRNSWGPEWGEKGYIRMQRGISDKKGLCGIAMEASYPIKKSATNPTGPSDYP 645
            CGSCWAFSTI AVEGIN I+T  L++LSEQELVDCDT  N+GCNGGLM+ AFEFI K GG+ T+  YPY+  DGTCD  ++++  V+ID +E+VP   E++L KAVA QP+S+AI+AG   FQ Y  G+F G CGT+L+HGV AVGYGT  +G  YWIVRNSWG  WGE GY+RM R I+   G CGIA+E SYPI K+  NP  P   P
Sbjct:  158 CGSCWAFSTIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPYKGVDGTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVAHQPISIAIEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTE-NGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPI-KNGENPPNPGPSP 365          
The following BLAST results are available for this feature:
BLAST of DC900201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 179
Match NameE-valueIdentityDescription
CYSEP_RICCO3.570e-10784.19Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1[more]
CYSEP_PHAVU4.226e-10079.53Vignain OS=Phaseolus vulgaris PE=2 SV=2[more]
CYSEP_VIGMU5.520e-10080.00Vignain OS=Vigna mungo PE=1 SV=1[more]
CYSP_HEMSP3.474e-8672.09Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN10... [more]
CYSP2_HORVU1.048e-7464.11Cysteine proteinase EP-B 2 OS=Hordeum vulgare GN=E... [more]
CYSP1_HORVU3.050e-7464.68Cysteine proteinase EP-B 1 OS=Hordeum vulgare GN=E... [more]
ORYA_ORYSJ1.159e-7362.38Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
CYSP1_ORYSJ4.404e-7363.08Cysteine protease 1 OS=Oryza sativa subsp. japonic... [more]
ORYB_ORYSJ7.512e-7361.32Oryzain beta chain OS=Oryza sativa subsp. japonica... [more]
RD21A_ARATH9.812e-7360.48Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900201 VSS Citrus sinensis cDNA clone VS28238 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900201 ID=DC900201|Name=DC900201|organism=Citrus sinensis|type=EST|length=804bp
AATTCGGCACGAGAATGCGGTAGCTGCTGGGCTTTTTCAACAATTGCAGC
AGTAGAGGGCATTAATCACATTATGACAAATAAGCTCGTTTCTTTGTCTG
AGCAAGAGTTAGTTGATTGTGACACTGATCAAAACCAAGGATGTAATGGA
GGGCTAATGGAATTGGCATTTGAGTTCATCAAGAAAAAGGGTGGCGTAAC
AACAGAGGCTAAGTACCCTTACCAAGCTAATGATGGAACATGTGACGTTT
CAAAGGAAAGTTCCCCAGCAGTGTCAATTGACGGACATGAAAATGTACCT
GCTAATCACGAGGATGCTCTGCTTAAGGCAGTTGCAAAACAGCCTGTGTC
AGTAGCCATAGATGCCGGCAGTTCAGATTTCCAGTTCTATTCAGAGGGTG
TATTTACTGGAGAATGTGGCACAGAGCTGAATCATGGAGTTGCAGCTGTG
GGCTACGGTACAACACTCGATGGAACCAAGTATTGGATAGTGAGGAACTC
ATGGGGACCTGAATGGGGAGAGAAGGGTTACATCAGAATGCAGCGCGGCA
TCTCAGACAAAAAGGGACTCTGTGGTATTGCAATGGAAGCTTCATATCCC
ATCAAGAAATCTGCAACAAACCCAACAGGACCTTCAGATTATCCTAAGGA
TGAGCTCTAGACACGGTTCACTATTGTCTTTGGCTTTTCTCTGCATTTCA
AGCTCAGCGGTTATCTCTTCTGTGTTAAAGTTGCATGTAATATGCCCTTG
TGATTCATGATTGAATAATGTTTCGATTTATGCAAATAAAGCCAACATTT
TACA
back to top