DC900200

Overview
NameDC900200
Unique NameDC900200
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1028
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: OLP1_SOLLC (Osmotin-like protein OS=Solanum lycopersicum PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 2.057e-55
Identity = 95/118 (80.51%), Postives = 105/118 (88.98%), Query Frame = 1
Query:  385 ALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFCH 738
            +LVDGFN+P+TVTPHEGKGVCPVVGCRA+LL +CP  LQ RS  GHG VV CKS CEAF +DE CCRNHYNSPQTC+ SS+S+FFKHACPAT TYAHDSPSLMH+CSSPRELKVIFCH
Sbjct:  135 SLVDGFNIPLTVTPHEGKGVCPVVGCRANLLESCPAVLQFRSHGGHGPVVGCKSACEAFKSDEFCCRNHYNSPQTCKPSSYSQFFKHACPATFTYAHDSPSLMHECSSPRELKVIFCH 252          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: TLPH_ARATH (Thaumatin-like protein OS=Arabidopsis thaliana GN=At1g18250 PE=2 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 9.322e-24
Identity = 52/117 (44.44%), Postives = 74/117 (63.25%), Query Frame = 1
Query:  385 ALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            +LVDG+N+ M++ P +G G C   GC +DL   CP  LQVRS  G  RVVACKS C AF + + CC   + +PQ+C+ +++S+ FK ACP   +YA+D P+ +  CS    + V FC
Sbjct:  124 SLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPVGLQVRSRNGK-RVVACKSACSAFNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYI-VTFC 238          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: TLP_PRUAV (Glucan endo-1,3-beta-glucosidase OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 6.680e-22
Identity = 49/117 (41.88%), Postives = 66/117 (56.41%), Query Frame = 1
Query:  385 ALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            +LVDGFN+PM+VTP  G G C    C A++ A CP  LQ +     G VVAC S C  FGT + CC    N+P+TC  +++SE F +ACP   +YA+D       C+      + FC
Sbjct:  130 SLVDGFNLPMSVTPQGGTGDCKTASCPANVNAVCPSELQKKG--SDGSVVACLSACVKFGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGGPNYAITFC 244          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: TP1A_MALDO (Thaumatin-like protein 1a OS=Malus domestica GN=TL1 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 3.315e-21
Identity = 47/117 (40.17%), Postives = 67/117 (57.26%), Query Frame = 1
Query:  385 ALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            +LVDGFN+PM+V P  G G C    C A++   CP  LQV++    G V++CKS C AFG  + CC    N+P+TC  + +SE F+  CP   +YA+D  +    CS   +  + FC
Sbjct:  131 SLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKA--ADGSVISCKSACLAFGDSKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFC 245          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: PR5_ARATH (Pathogenesis-related protein 5 OS=Arabidopsis thaliana GN=At1g75040 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.330e-21
Identity = 48/117 (41.03%), Postives = 66/117 (56.41%), Query Frame = 1
Query:  385 ALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            +LVDG+NV + + P  G G C   GC +DL A CP  L+V        VVACKS CE F TD+ CCR   + P+TC  + +S  FK+ACP   +YA+D  +    C+     ++ FC
Sbjct:  126 SLVDGYNVKLGIRPSGGSGDCKYAGCVSDLNAACPDMLKVMD---QNNVVACKSACERFNTDQYCCRGANDKPETCPPTDYSRIFKNACPDAYSYAYDDETSTFTCTG-ANYEITFC 238          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: TP1B_MALDO (Thaumatin-like protein 1b (Fragment) OS=Malus domestica PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 7.386e-21
Identity = 46/117 (39.32%), Postives = 67/117 (57.26%), Query Frame = 1
Query:  385 ALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            +LVDGFN+PM+V P  G G C    C A++   CP  LQV++    G V++CKS C AFG  + CC    ++P+TC  + +SE F+  CP   +YA+D  +    CS   +  + FC
Sbjct:   97 SLVDGFNLPMSVAPQGGTGECKPSSCPANVNMACPAQLQVKA--ADGSVISCKSACLAFGDSKYCCTPPNDTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFC 211          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: TLP1_PRUPE (Thaumatin-like protein 1 OS=Prunus persica PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.807e-20
Identity = 48/117 (41.03%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  385 ALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            +LVDGFN+PM+V P  G G C    C AD+   CP  LQV+     G V+ACKS C AF   + CC    + P+TC    +S+ FK  CP   +YA+D  S    CS      + FC
Sbjct:  131 SLVDGFNLPMSVAPQGGTGKCKASTCPADINKVCPAPLQVKG--SDGSVIACKSACLAFNQPKYCCTPPNDKPETCPPPDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPAYLITFC 245          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: TLP1_CASSA (Thaumatin-like protein 1 OS=Castanea sativa GN=TL1 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.807e-20
Identity = 45/127 (35.43%), Postives = 68/127 (53.54%), Query Frame = 1
Query:  355 SRRSLVITTFALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            + R +     +LVDG+N+P++V    G G C    CRA++ A CP  LQV+       V+ACKS C AF   + CC   +++ +TC A+ +S  FK  CP   +YA+D  +    CS   +  + FC
Sbjct:  118 ANRGMDFYDVSLVDGYNLPVSVATRGGTGDCKATSCRANVNAVCPAELQVKG--SDASVLACKSACTAFNQPQYCCTGAFDTARTCPATKYSRIFKQQCPQAYSYAYDDSTSTFTCSGAPDYVITFC 242          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: TLPH_ORYSJ (Thaumatin-like protein OS=Oryza sativa subsp. japonica GN=Os11g0706600 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 3.103e-19
Identity = 49/130 (37.69%), Postives = 66/130 (50.77%), Query Frame = 1
Query:  346 LSLSRRSLVITTFALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            L  S  ++     +LVDGFN P+++    G   C    C AD+   CP  L+VR     GRV  C+S C A G D  CC   Y SP  CR + FS  FK  CP   +YA+D  + ++ C + R L + FC
Sbjct:  122 LGTSASAMHFYDVSLVDGFNAPVSMAAVGGGVGCGTAACGADVNVCCPSALEVRDR--EGRVAGCRSACRAMGGDRYCCTGDYASPSACRPTIFSHLFKAICPRAYSYAYDDATSLNRCHAKRYL-ITFC 248          
BLAST of DC900200 vs. ExPASy Swiss-Prot
Match: TLP1_PYRPY (Thaumatin-like protein 1 OS=Pyrus pyrifolia GN=TL1 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.011e-18
Identity = 42/117 (35.90%), Postives = 59/117 (50.43%), Query Frame = 1
Query:  385 ALVDGFNVPMTVTPHEGKGVCPVVGCRADLLATCPQNLQVRSPPGHGRVVACKSGCEAFGTDELCCRNHYNSPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFC 735
            +LVDGFN+P+ + P  G G C    C A++   CP  L  +     G V+ CKS C A    + CC   Y +P TC  + FS+ FK+ CP   +YA+D  S    C      ++ FC
Sbjct:  129 SLVDGFNLPIKLAPRGGSGDCNSTSCAANINTVCPAELSDKG--SDGSVIGCKSACLALNQPQYCCTGAYGTPDTCPPTDFSKVFKNQCPQAYSYAYDDKSSTFTCFGGPNYEITFC 243          
The following BLAST results are available for this feature:
BLAST of DC900200 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
OLP1_SOLLC2.057e-5580.51Osmotin-like protein OS=Solanum lycopersicum PE=1 ... [more]
TLPH_ARATH9.322e-2444.44Thaumatin-like protein OS=Arabidopsis thaliana GN=... [more]
TLP_PRUAV6.680e-2241.88Glucan endo-1,3-beta-glucosidase OS=Prunus avium P... [more]
TP1A_MALDO3.315e-2140.17Thaumatin-like protein 1a OS=Malus domestica GN=TL... [more]
PR5_ARATH4.330e-2141.03Pathogenesis-related protein 5 OS=Arabidopsis thal... [more]
TP1B_MALDO7.386e-2139.32Thaumatin-like protein 1b (Fragment) OS=Malus dome... [more]
TLP1_PRUPE2.807e-2041.03Thaumatin-like protein 1 OS=Prunus persica PE=2 SV... [more]
TLP1_CASSA2.807e-2035.43Thaumatin-like protein 1 OS=Castanea sativa GN=TL1... [more]
TLPH_ORYSJ3.103e-1937.69Thaumatin-like protein OS=Oryza sativa subsp. japo... [more]
TLP1_PYRPY2.011e-1835.90Thaumatin-like protein 1 OS=Pyrus pyrifolia GN=TL1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900200 VSS Citrus sinensis cDNA clone VS28237 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900200 ID=DC900200|Name=DC900200|organism=Citrus sinensis|type=EST|length=1028bp
CTAGTCTCGAGTTTTTTTTTTTTTTTTTTATTACCAAGAAATTTTAAAAT
ATAGAATTAAAATTGAAACGACGAGGAGAAAATCCAAAGAAGTATCTTAA
ATCTCCAACATAAGCCCATAATCGGATCCTCATGACATAACACAATAACA
ATAGAAATATCTTAGTGACATTGCCAAAACAAAACATCCTAAATCCATAA
ATTCTATGATTAAACAAAAACTTTAAAAACAACCTCTTATCAAAATTAGT
CAACGCTCTGCATAATATCCTCTGGGGTGAACTTGGTACCCTTCTCCTTG
TCGGCGGCGGCACGTCCCTTGGCCTTGCGATCGAGCAAAGACTTCCTGTC
CTTGTCCAGACGGAGCTTGGTGATCACGACCTTTGCTCTAGTCGACGGCT
TCAACGTCCCCATGACTGTCACCCCGCACGAGGGCAAGGGCGTCTGTCCG
GTAGTGGGTTGTCGCGCTGACCTGCTAGCCACGTGTCCTCAGAACCTGCA
GGTGAGGTCACCGCCGGGTCACGGCCGCGTGGTGGCATGTAAGAGTGGGT
GTGAGGCGTTTGGTACGGACGAGCTGTGTTGTAGGAACCATTACAACAGT
CCGCAGACATGCCGGGCTTCGAGCTTTTCGGAGTTCTTCAAGCACGCTTG
TCCAGCCACGATGACTTATGCCCATGACAGCCCTTCGCTCATGCATGACT
GCTCCTCGCCACGTGAGCTAAAAGTTATTTTCTGTCACTAGAGAAGCATG
AGAATAATAATAAGCTGGAGCATCAAGCTTCACAGTGCTTAGGATTGTTG
TGTTTGTTTTCGTCAATTAGCAGTATCTTGCTTTTTAATTAATCTCGTAA
CTAAAAAGAGAAATTAAAAATGATCAATGTGAGCTTGTGTCATGTTGGGT
GTCATCAGTCTGTACGTTGTGGTGTGTTTTGTAAGTTCCAATTCAATTTG
GAATGGGAATGTAATGAGTTTGATGTGTGGTATATTTTCTTTTTTCATGA
AAAAGTAAAATAGAAATATTTTTCTTCA
back to top