CX043363

Overview
NameCX043363
Unique NameCX043363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length813
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIK2_ARATH (3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana GN=PED1 PE=1 SV=2)

HSP 1 Score: 358.992 bits (920), Expect = 1.799e-98
Identity = 176/215 (81.86%), Postives = 198/215 (92.09%), Query Frame = -3
Query:  167 PKTGVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDELCNARMVPTHTHLSKDAK 811
            PKTG EK +T+SVDDGIRP TT+A L KLKP FKKDGTTTAGN+SQVSDGAGAVLLMKRS+A+QKGLP+LGVFR+F+AVGVDP++MGIGPAVAIPAAVK+AGL++DDI+LFEINEAFASQ+VYC  KLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL EMKRRGKDCRFGV+SMCIG+GMGAAAVFERGD VDEL NAR V     LSKDA+
Sbjct:  248 PKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR 462          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIK1_ARATH (3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana GN=KAT1 PE=1 SV=2)

HSP 1 Score: 345.125 bits (884), Expect = 2.688e-94
Identity = 165/204 (80.88%), Postives = 192/204 (94.12%), Query Frame = -3
Query:  200 PKTGVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDELCNARMV 811
            PKTG EK +T+SVDDGIRPNTT++ LAKLKP FK+DGTTTAGN+SQ+SDGAGAVLLM+R++A+QKGLPILGVFR+FSAVGVDP++MG+GPAVAIPAAVK+AGL+++D++LFEINEAFASQ+VYC  KLGLD EK+NVNGGA+A+GHPLGATGARCVATLL EMKRRGKDCRFGV+SMCIGSGMGAAAVFERG  VDELC+ R V
Sbjct:  240 PKTGDEKPITVSVDDGIRPNTTLSGLAKLKPVFKEDGTTTAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV 443          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIK5_ARATH (3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana GN=KAT5 PE=2 SV=2)

HSP 1 Score: 329.717 bits (844), Expect = 1.169e-89
Identity = 163/209 (77.99%), Postives = 184/209 (88.04%), Query Frame = -3
Query:  185 PKTGVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDCVDELCNARMVPTHTH 811
            P+T  EK + +SVDDG+RPN+ +ADLAKLK  FK++G+TTAGNASQ+SDGAGAVLLMKRSLA++KGLPILGVFRSF+  GV+PSVMGIGPAVAIPAA K AGL + DI+LFEINEAFASQYVY  KKL LD EKVNVNGGA+A+GHPLGATGARCVATLL EMKRRGKDCRFGVISMCIG+GMGAAAVFERGD VD L NAR+    +H
Sbjct:  249 PETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKQNGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGDSH 457          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIK_HUMAN (3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens GN=ACAA1 PE=1 SV=2)

HSP 1 Score: 257.299 bits (656), Expect = 7.371e-68
Identity = 127/187 (67.91%), Postives = 156/187 (83.42%), Query Frame = -3
Query:  242 GVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFE 802
            G ++ +T++ D+GIRP+TT+  LAKLKPAFKKDG+TTAGN+SQVSDGA A+LL +RS A + GLPILGV RS++ VGV P +MGIGPA AIP A++ AGL + D+++FEINEAFASQ  YC++KL L PEKVN  GGAVALGHPLG TGAR V TLL+E+KRRGK   +GV+SMCIG+GMGAAAVFE
Sbjct:  235 GTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRA-YGVVSMCIGTGMGAAAVFE 420          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIKB_MOUSE (3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus GN=Acaa1b PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 2.145e-67
Identity = 128/187 (68.45%), Postives = 157/187 (83.96%), Query Frame = -3
Query:  242 GVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFE 802
            G +K +T+S D+G+RP+TT+  LAKLKPAFK  G+TTAGN+SQVSDGA AVLL +RS A + GLPILGV RS++ VGV P VMGIGPA AIPAA++ AGL ++DI++FEINEAFASQ VYC++KLG+  EKVN  GGA+ALGHPLG TGAR V TLL+E+KRRG+   +GV+SMCIG+GMGAAAVFE
Sbjct:  235 GDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE 420          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIKA_MOUSE (3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus GN=Acaa1a PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 2.145e-67
Identity = 128/187 (68.45%), Postives = 157/187 (83.96%), Query Frame = -3
Query:  242 GVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFE 802
            G +K +T+S D+G+RP+TT+  LAKLKPAFK  G+TTAGN+SQVSDGA AVLL +RS A + GLPILGV RS++ VGV P VMGIGPA AIPAA++ AGL ++DI++FEINEAFASQ VYC++KLG+  EKVN  GGA+ALGHPLG TGAR V TLL+E+KRRG+   +GV+SMCIG+GMGAAAVFE
Sbjct:  235 GDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE 420          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIKB_RAT (3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus GN=Acaa1b PE=2 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 8.150e-67
Identity = 126/187 (67.38%), Postives = 156/187 (83.42%), Query Frame = -3
Query:  242 GVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFE 802
            G  K +T+S D+G+RP+TT+  LAKLKPAFK  G+TTAGN+SQVSDGA AVLL +RS A + GLPILGV RS++ VGV P +MGIGPA AIPAA++ AGL ++DI++FEINEAFASQ +YC++KLG+  EKVN  GGA+ALGHPLG TGAR V TLL+E+KRRG+   +GV+SMCIG+GMGAAAVFE
Sbjct:  235 GDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE 420          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIKA_RAT (3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus GN=Acaa1a PE=2 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 8.150e-67
Identity = 126/187 (67.38%), Postives = 156/187 (83.42%), Query Frame = -3
Query:  242 GVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFE 802
            G  K +T+S D+G+RP+TT+  LAKLKPAFK  G+TTAGN+SQVSDGA AVLL +RS A + GLPILGV RS++ VGV P +MGIGPA AIPAA++ AGL ++DI++FEINEAFASQ +YC++KLG+  EKVN  GGA+ALGHPLG TGAR V TLL+E+KRRG+   +GV+SMCIG+GMGAAAVFE
Sbjct:  235 GDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE 420          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: THIK_YARLI (3-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia lipolytica GN=POT1 PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 4.483e-57
Identity = 113/183 (61.75%), Postives = 139/183 (75.96%), Query Frame = -3
Query:  248 EKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAV 796
            EK VT++ DDGIRP  T   L KLKPAF  +GTT AGNASQ+SDGAGAVLLM+RS+A + G PIL  F     VGV P +MGIGPA AIPA ++  GL ++D+++FEINEAFASQ ++ I+  G+D  KVN  GGA+A+GHPLGATGAR  ATLLSE+K  GK  + GV SMCIG+GMGAA++
Sbjct:  230 EKEVTVNKDDGIRPGVTAEKLGKLKPAFSAEGTTHAGNASQISDGAGAVLLMRRSVAEKLGQPILAKFVHCKTVGVPPELMGIGPAYAIPAVLEDLGLTVNDVDVFEINEAFASQALFSIQHCGIDESKVNPRGGAIAIGHPLGATGARQFATLLSELKESGK--KVGVTSMCIGTGMGAASL 410          
BLAST of CX043363 vs. ExPASy Swiss-Prot
Match: FADA_BACSU (3-ketoacyl-CoA thiolase OS=Bacillus subtilis GN=fadA PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.703e-56
Identity = 113/186 (60.75%), Postives = 137/186 (73.66%), Query Frame = -3
Query:  242 VEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGVISMCIGSGMGAAAVFE 799
            +EK+   S D+G+RP TT   L+ L+PAF  DGT TAGN+SQ SDGA AV+LM R  A   GL  L  FRSF+  GV P VMGIGP  AIP A+K AGLQ+ DI LFE+NEAFASQ +  I++LG+D EKVNVNGGA+ALGHPLG TG +   +L+ EMKRR +  +FGV++MCIG GMGAA VFE
Sbjct:  206 MEKQFVFSQDEGVRPQTTADILSTLRPAFSVDGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIPRALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKLTLSLIHEMKRRNE--QFGVVTMCIGGGMGAAGVFE 389          
The following BLAST results are available for this feature:
BLAST of CX043363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 283
Match NameE-valueIdentityDescription
THIK2_ARATH1.799e-9881.863-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidop... [more]
THIK1_ARATH2.688e-9480.883-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidop... [more]
THIK5_ARATH1.169e-8977.993-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidop... [more]
THIK_HUMAN7.371e-6867.913-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapie... [more]
THIKB_MOUSE2.145e-6768.453-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musc... [more]
THIKA_MOUSE2.145e-6768.453-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musc... [more]
THIKB_RAT8.150e-6767.383-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus n... [more]
THIKA_RAT8.150e-6767.383-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus n... [more]
THIK_YARLI4.483e-5761.753-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia l... [more]
FADA_BACSU1.703e-5660.753-ketoacyl-CoA thiolase OS=Bacillus subtilis GN=fa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10E12_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10E12-J24-1-6.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043363 ID=CX043363; Name=CX043363; organism=Citrus sinensis; type=EST; length=813bp
CCAAAATTGCACACCATTGGATCTGAAAACAGATTGTTTGATAGTTAGCA
ATGGCTTTATTATGTTTCAACTAATACCCATAGTACCCATCATCAACTAA
TTTTGAAATTCAACCAATCCATGCTTACATAAAACAGTGAGATGCAATTG
CAAACAAATGCATCTACTTGGCATCCTTTGACAAGTGGGTGTGAGTTGGA
ACCATTCGAGCATTGCATAGTTCGTCAACACAATCTCCTCTCTCGAAAAC
TGCTGCAGCCCCCATGCCTGAGCCTATGCACATGGAGATCACTCCAAATC
GACAATCTTTGCCACGACGCTTCATCTCACTCAATAGAGTTGCAACACAG
CGTGCACCTGTCGCACCCAGAGGATGCCCAAGAGCCACTGCACCTCCATT
AACATTGACTTTTTCAGGATCAAGCCCCAGTTTCTTAATACAATAAACAT
ACTGGGATGCAAATGCCTCATTTATCTCAAACAAATTAATATCATCAATC
TGAAGACCTGCAGACTTCACTGCAGCAGGTATTGCAACAGCTGGGCCTAT
GCCCATGACAGAAGGATCTACACCAACAGCAGAAAAACTCCTGAACACAC
CAAGAATTGGAAGACCCTTCTGCACAGCCAAACTTCTCTTCATAAGAAGA
ACTGCTCCAGCTCCATCACTGACCTGGCTAGCATTCCCAGCAGTTGTCGT
CCCATCCTTTTTAAATGCAGGCTTCAGCTTAGCCAGATCTGCAATTGTTG
TGTTTGGTCGAATTCCATCATCCACAGAAATTGTGACACGCTTCTCCACT
CCAGTTTTTGGGT
back to top