DC900196

Overview
NameDC900196
Unique NameDC900196
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7124 contig Csv1_Contig7124:970..1699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 1.920e-61
Identity = 119/136 (87.50%), Postives = 127/136 (93.38%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG
Sbjct:  301 KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.527e-61
Identity = 116/136 (85.29%), Postives = 127/136 (93.38%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDPTG
Sbjct:  301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.244e-60
Identity = 111/119 (93.28%), Postives = 118/119 (99.16%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDPTG
Sbjct:  318 KDDPAKDAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.122e-60
Identity = 112/119 (94.12%), Postives = 117/119 (98.32%), Query Frame = 2
Query:   62 KDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDPTG
Sbjct:  318 KDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.772e-60
Identity = 115/136 (84.56%), Postives = 127/136 (93.38%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct:  301 KNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 231.876 bits (590), Expect = 2.772e-60
Identity = 116/136 (85.29%), Postives = 126/136 (92.65%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AANFT+QVII+NHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG
Sbjct:  301 KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.728e-60
Identity = 115/136 (84.56%), Postives = 126/136 (92.65%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSE++TKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct:  301 KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.053e-59
Identity = 113/136 (83.09%), Postives = 127/136 (93.38%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGV+KNV+KKDPTG
Sbjct:  301 KNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.797e-59
Identity = 115/136 (84.56%), Postives = 125/136 (91.91%), Query Frame = 2
Query:   17 KNV-LQGSQRGL-CXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG+     KDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP+G
Sbjct:  301 KNVAVKDLKRGIVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG 436          
BLAST of DC900196 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 8.917e-59
Identity = 114/136 (83.82%), Postives = 123/136 (90.44%), Query Frame = 2
Query:   17 KNV-LQGSQRG-LCXQPKDDPARXAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 418
            KNV ++  +RG +    KDDPA+ AANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+ TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETF  YPPLGRFAVRDMRQTVAVGVIK+VEKKDPTG
Sbjct:  301 KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
The following BLAST results are available for this feature:
BLAST of DC900196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A_ORYSJ1.920e-6187.50Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_VICFA9.527e-6185.29Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_PEA1.244e-6093.28Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_MAIZE2.122e-6094.12Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_TOBAC2.772e-6084.56Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_SOYBN2.772e-6085.29Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_ARATH4.728e-6084.56Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_SOLLC1.053e-5983.09Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_MANES1.797e-5984.56Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A2_DAUCA8.917e-5983.82Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900196 VSS Citrus sinensis cDNA clone VS28233 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900196 ID=DC900196|Name=DC900196|organism=Citrus sinensis|type=EST|length=730bp
CAATGTGGCTCAACGTAAGAACGTGCTGCAAGGATCCCAGCGTGGTTTGT
GCTNCCAACCGAAGGATGATCCGGCCAGGNAAGCTGCCAACTTCACCTCA
CAGGTCATCATCATGAACCACCCTGGCCAGATTGGAAATGGATATGCCCC
AGTGCTTGACTGCCACACCTCCCACATTGCCGTCAAGTTTTCTGAGCTCG
TGACGAAGATTGATAGGCGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAG
TTCTTGAAGAATGGAGATGCTGGAATGGTTAAGATGATTCCCACCAAGCC
CATGGTTGTTGAAACCTTCTCTGACTACCCACCTCTTGGTCGTTTTGCCG
TTAGGGACATGCGTCAGACTGTTGCTGTTGGTGTGATTAAGAATGTTGAA
AAGAAGGATCCAACAGGTGCCAAGGTCACCAAGTCTGCAGCCAAGAAGAA
GTGAATCGGGTTGGTTAATGTTGCTTTATCCGCAGATGGAGTCTATTTTA
ATAATTGTAGTTATACAAACTTGGTTATTTTTGGTACTGTTATAGTTCGA
TGCATGCTTTCCTTTTTAGGTTTTAGTTTGTTGCCTTTGGTGTCGGGTAN
NGATTCCCAGAATTGGGTGCTTGACAGGCGGTGGCGCAGCTCTAACCTGG
AGTCTCAATTTTATTAATAGTTATGGTCTTTGTTTGTATTGATACTTGAG
GTGGTTCGGTTTCATCTGAATCGGCTCAGA
back to top