CN186133

Overview
NameCN186133
Unique NameCN186133
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length809
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: TXND9_MOUSE (Thioredoxin domain-containing protein 9 OS=Mus musculus GN=Txndc9 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.857e-33
Identity = 72/136 (52.94%), Postives = 91/136 (66.91%), Query Frame = -3
Query:  274 RIAALKKEAEKRQVLQMKGHGEYREIG-EGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGGKDDFTTKTLEVLLVKKGVIS 678
            R+AAL+K  +++Q    KGHGEYREIG E DF  EV  SEK +CHFY    +RCKI+D+HL  LA KH+ TKF+KL+ E APF   +L IK +P + + R G   D +VGF DLG  DDFTT+TLE  L    VI+
Sbjct:   51 RLAALRKAQQQKQEWLSKGHGEYREIGSERDFFQEVKESEKVVCHFYRDTTFRCKILDRHLAILAKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALLRDGKTQDYVVGFTDLGNTDDFTTETLEWRLGCSDVIN 186          
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: PHLP3_DICDI (Phosducin-like protein 3 OS=Dictyostelium discoideum GN=phlp3 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.305e-32
Identity = 66/134 (49.25%), Postives = 93/134 (69.40%), Query Frame = -3
Query:  277 RIAALKKEAEKRQVLQMKGHGEYREIGEGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGGKDDFTTKTLEVLLVKKGVI 678
            R+  LK+E++ +Q   +  HGE +EI E DFL EVTG++  + HFYH +F RCKI+DK L+ LA  H+GTKF+K++AE A FF  KLGI+ LP ++ F  GIA+DR VGF++ GG D F  + L + + K GV+
Sbjct:   27 RMKQLKEESKLKQSF-LSTHGELKEIDEQDFLKEVTGTDNVVVHFYHSDFQRCKILDKSLEILAKTHLGTKFLKVNAEKAQFFTGKLGIRILPTLVFFSNGIAVDRCVGFEEFGGIDSFKIEQLAIRISKAGVL 159          
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: TXND9_RAT (Thioredoxin domain-containing protein 9 OS=Rattus norvegicus GN=Txndc9 PE=2 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 2.907e-32
Identity = 71/136 (52.21%), Postives = 90/136 (66.18%), Query Frame = -3
Query:  274 RIAALKKEAEKRQVLQMKGHGEYREIG-EGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGGKDDFTTKTLEVLLVKKGVIS 678
            R+AAL+K  +++Q    KGHGEYREIG E DF  EV  SEK +CHFY    +RCKI+D+HL  LA KH+ TKF+K + E APF   +L IK +P + + R G   D +VGF DLG  DDFTT+TLE  L    VI+
Sbjct:   51 RLAALRKAQQQKQEWLSKGHGEYREIGSERDFFQEVKESEKVVCHFYRDTTFRCKILDRHLAILAKKHLETKFLKPNVEKAPFLCERLRIKVIPTLALLRDGKTQDYIVGFTDLGNTDDFTTETLEWRLGCSDVIN 186          
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: TXND9_HUMAN (Thioredoxin domain-containing protein 9 OS=Homo sapiens GN=TXNDC9 PE=1 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 1.595e-30
Identity = 65/136 (47.79%), Postives = 88/136 (64.71%), Query Frame = -3
Query:  274 RIAALKKEAEKRQVLQMKGHGEYREI-GEGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGGKDDFTTKTLEVLLVKKGVIS 678
            R+ AL+K  +++Q    KGHGEYREI  E DF  EV  SE  +CHFY    +RCKI+D+HL  L+ KH+ TKF+KL+ E APF   +L IK +P + + + G   D +VGF DLG  DDFTT+TLE  L    +++
Sbjct:   51 RLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILN 186          
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: TXND9_BOVIN (Thioredoxin domain-containing protein 9 OS=Bos taurus GN=TXNDC9 PE=2 SV=2)

HSP 1 Score: 130.954 bits (328), Expect = 7.916e-30
Identity = 64/126 (50.79%), Postives = 84/126 (66.67%), Query Frame = -3
Query:  304 RIAALKKEAEKRQVLQMKGHGEYREI-GEGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGGKDDFTTKTLE 678
            R+ ALKK  +++Q    KGHGEYREI  E DF  E   S+K +CHFY    +RCKI+D+HL  L+ KH+ TKF+KL+ E APF   +L IK +P + + + G   D +VGF DLG  DDFTT+TLE
Sbjct:   51 RLEALKKAQQQKQEWLSKGHGEYREIPSERDFFQEDKESKKVVCHFYRDSTFRCKILDRHLVILSKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDFVVGFSDLGNTDDFTTETLE 176          
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: TXND9_ARATH (Thioredoxin domain-containing protein 9 homolog OS=Arabidopsis thaliana GN=At2g18990 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 7.409e-28
Identity = 70/168 (41.67%), Postives = 98/168 (58.33%), Query Frame = -3
Query:  178 RIAALKKEAEKRQVLQMKGHGEYREI-GEGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGGKDDFTTKTLEVLLVKKGVISXXXXXXXXXXXEYQENRHRTVRCSVDPDSDSD 678
            R+  +KK AEK++     GHGEY EI  E DF + V  SE+ +CHFY +E + CK+MDKH+  LA +HI T+F+K+ AE +PF   +L I  LP + + +     D +VGF +LGGKDDF+T+ LE  + +  VI               + R R VR S   DSDS+
Sbjct:   46 RLKQMKKMAEKKKRWISLGHGEYSEIHSEKDFFSVVKASERVVCHFY-RENWPCKVMDKHMSILAKQHIETRFVKIQAEKSPFLAERLKIVVLPTLALIKNTKVDDYVVGFNELGGKDDFSTEDLEERIARAQVIHYDGESSSLKPKSTTQVR-RNVRQSARSDSDSE 211          
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: YERC_SCHPO (Thioredoxin domain-containing protein C2F3.12c OS=Schizosaccharomyces pombe GN=SPAC2F3.12c PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 6.272e-27
Identity = 58/135 (42.96%), Postives = 84/135 (62.22%), Query Frame = -3
Query:  277 RIAALKKEAEKRQVLQMKGHGEYREI-GEGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGGKDDFTTKTLEVLLVKKGVI 678
            R+  LKKE  + +  + KGH ++  +  E + +     S+K + HFYH +F RCKI+D HL+ +A  H  TKFI+++A NAPF V KLG+K LP V+ +     +D+++GF DLG KDDF T  LE  L+K   I
Sbjct:  115 RLEMLKKEFARVEAAKEKGHMQFLTVENEREVMDFTLSSKKVVIHFYHPDFIRCKIIDSHLEKIAKVHWETKFIRIEAANAPFLVVKLGLKVLPAVLCYVNSQLVDKIIGFADLGNKDDFETSLLEFRLLKSSAI 249          
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: TXND9_CAEEL (Thioredoxin domain-containing protein 9 homolog OS=Caenorhabditis elegans GN=tag-170 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.708e-24
Identity = 55/136 (40.44%), Postives = 84/136 (61.76%), Query Frame = -3
Query:  274 RIAALKKEAEKRQVLQMKGHGEYREIG-EGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGGKDDFTTKTLEVLLVKKGVIS 678
            R+  +KK  + R  +   GHG+Y E+  E +F      S+K +C FY    +RCKI+DKH + LA KH+GT+FI ++AE   F  T+L I+ +P + I  K   +D + GF +LGGKD+FTT+T+E  L +  V++
Sbjct:   46 RMEQMKKAQKDRIEMLSHGHGKYEEVADEKEFFEATKKSDKVVCLFYLPGNFRCKIVDKHFEILARKHVGTRFIHVNAEKVHFLTTRLNIRVIPSIAIVVKQQTVDYIRGFDELGGKDEFTTETMENRLARSEVLT 181          
BLAST of CN186133 vs. ExPASy Swiss-Prot
Match: PLP1_YEAST (Phosducin-like protein 1 OS=Saccharomyces cerevisiae GN=PLP1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.947e-13
Identity = 47/138 (34.06%), Postives = 73/138 (52.90%), Query Frame = -3
Query:  277 SDRIAALKKEAEKRQVLQMKGHGEYREI-GEGDFLAEVTGSEKAICHFYHKEFYRCKIMDKHLKALAPKHIGTKFIKLDAENAPFFVTKLGIKTLPCVIIFRKGIAIDRLVGFQDLGG-KDDFTTKTLEVLLVKKGVI 684
            SD +  +KK  E        G+G  + I  E D +   T +   + HF  + F +C+ M++ L+ LA +++ T+FIK++ +  PF V KL IK LP V+ ++ G+   R VGF  LG   + F  + LE  L   GVI
Sbjct:   66 SDHLKQVKKNVED------DGYGRLQCIDNEADAIQICTKTTMVVIHFELETFGKCQYMNEKLENLAKRYLTTRFIKVNVQTCPFLVNKLNIKVLPFVVGYKNGLEKVRYVGFSKLGNDPNGFDIRRLEQSLAHSGVI 197          
The following BLAST results are available for this feature:
BLAST of CN186133 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
TXND9_MOUSE5.857e-3352.94Thioredoxin domain-containing protein 9 OS=Mus mus... [more]
PHLP3_DICDI1.305e-3249.25Phosducin-like protein 3 OS=Dictyostelium discoide... [more]
TXND9_RAT2.907e-3252.21Thioredoxin domain-containing protein 9 OS=Rattus ... [more]
TXND9_HUMAN1.595e-3047.79Thioredoxin domain-containing protein 9 OS=Homo sa... [more]
TXND9_BOVIN7.916e-3050.79Thioredoxin domain-containing protein 9 OS=Bos tau... [more]
TXND9_ARATH7.409e-2841.67Thioredoxin domain-containing protein 9 homolog OS... [more]
YERC_SCHPO6.272e-2742.96Thioredoxin domain-containing protein C2F3.12c OS=... [more]
TXND9_CAEEL1.708e-2440.44Thioredoxin domain-containing protein 9 homolog OS... [more]
PLP1_YEAST3.947e-1334.06Phosducin-like protein 1 OS=Saccharomyces cerevisi... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G17_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186133 ID=CN186133|Name=CN186133|organism=Citrus sinensis|type=EST|length=809bp
TTTTTTTTTTTTTTTTGCTAGAATATAAATTTATAACTACTTTTTTAATC
ACCAATATGATTTTCTTGGGACAATAGAAAAACCTTAAATGTGCATATAG
TTATACAAGCTCACATTTATTAAGTCAACTGACATTCCAGGAAAGAAACC
ACATTTTCATTTTCAGATTTCACGTCAGTCAGAATCAGAGTCTGGATCCA
CAGAGCATCTCACCGTCCTGTGCCTATTCTCCTGATATTCATCCTCTTCA
TCATCTTCATTCTCTTTCTTCTCGCTAATTACACCTTTCTTTACTAGTAG
AACCTCAAGTGTCTTTGTGGTGAAATCATCTTTTCCTCCCAGATCTTGAA
ATCCAACCAGCCTATCTATAGCAATTCCTTTTCTGAATATTATGACACAA
GGCAAAGTTTTAATTCCAAGTTTGGTCACGAAGAAGGGTGCATTCTCTGC
ATCCAGCTTGATAAACTTCGTACCAATATGCTTTGGTGCAAGGGCCTTCA
AATGTTTATCCATTATCTTGCAGCGATAGAACTCCTTATGGTAGAAGTGG
CAAATCGCTTTCTCACTTCCAGTGACTTCAGCCAAGAAATCCCCTTCACC
TATCTCCCTGTATTCTCCATGTCCTTTCATTTGCAAGACTTGTCGCTTCT
CAGCTTCTTTCTTGAGAGCTGCAATCCTGTCCGAATGCAATTTTTCCAGC
TCAGGATCATCCATCAGTTCATCGAGGTCAACTTCGTCGTTAGAACTTGA
AGCCTGAGCCTTCTCTTTATCAAGCAGTTCCTTTTGATAATCACGAGCAG
CTGCCGCAA
back to top