DC900179

Overview
NameDC900179
Unique NameDC900179
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length697
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig132 contig Csv1_Contig132:510..1204. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900179 vs. ExPASy Swiss-Prot
Match: UBC32_ARATH (Ubiquitin carrier protein E2 32 OS=Arabidopsis thaliana GN=UBC32 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.080e-14
Identity = 54/127 (42.52%), Postives = 64/127 (50.39%), Query Frame = 2
Query:   92 PLSLSSAPVKNSLATGRVKHRQSSIDAMVAGAGEGLPAPVGDRIIEEVQEDXXXXXXXXXXXXGTSR-EVPANASGVQLQPKPETRVQKPADDRLFTWAAVGLTIAILVLLLRKFMKSNGHGAVFMD 469
            PL  S AP   S A  +V+  Q +I  +   +       V D+IIEE  E                  EV   AS    Q       QKP DDRLFTWAAVGLTIAI+VLLL+KF+KSNG+   FMD
Sbjct:  181 PLECSQAPSIVSEAHSQVEP-QEAITVVEERSIATTDTIVDDQIIEETAEAVNTAASVVPAAAPLPAVEVVVKASVSGEQRMARRAAQKPVDDRLFTWAAVGLTIAIMVLLLKKFIKSNGYSTGFMD 306          

HSP 2 Score: 27.335 bits (59), Expect = 2.080e-14
Identity = 11/16 (68.75%), Postives = 14/16 (87.50%), Query Frame = 1
Query:   58 DEIHEYMLSKAPPVPQ 105
            DEIH+Y+LSKA  VP+
Sbjct:  163 DEIHQYILSKATVVPK 178          
The following BLAST results are available for this feature:
BLAST of DC900179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
UBC32_ARATH2.080e-1442.52Ubiquitin carrier protein E2 32 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900179 VSS Citrus sinensis cDNA clone VS28204 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900179 ID=DC900179|Name=DC900179|organism=Citrus sinensis|type=EST|length=697bp
AGAAAAGCGGCCTGCACAATCCGTAAGCGCCCAAATTGGACTCTGACGCA
AACTCATGATGAGATCCATGAATATATGTTAAGCAAGGCACCCCCTGTCC
CTCAGCTCAGCACCTGTGAAGAACAGCCTGGCAACAGGGAGGGTGAAGCA
CAGGCAAAGTTCCATAGACGCCATGGTTGCGGGTGCTGGGGAAGGGCTCC
CAGCCCCAGTAGGTGATAGGATTATTGAAGAAGTTCAGGAGGATGTTCCT
GCCAGCGTGAATCCCAACCCCGTAGTGGCTGGAACATCAAGAGAGGTTCC
TGCCAACGCCTCTGGAGTCCAGCTTCAGCCAAAACCGGAGACTAGGGTTC
AAAAACCTGCTGATGATCGACTGTTCACATGGGCTGCTGTTGGACTTACT
ATTGCAATTTTGGTTCTTTTACTGAGGAAATTCATGAAATCTAATGGTCA
TGGTGCTGTTTTCATGGATGGTTCGTAGATATGCTATCGGTTTCGTCAAA
TCTGGGAGTTCAAAATTTCCAAGTCATAGTAGTTAAGGGAGAAATTATCA
TCAAGGGCATTAATCTTTATTGAAACAGTTTGTCGTATATATGATCTTTT
ATACCCCATGACTGTAATTTCATACGCAATTGTAAGCCAGATTGTCCTGT
CATTTTGTACACAATTTGGATATCTATATTTCATGCTACTTTGTCCT
back to top