CN186126

Overview
NameCN186126
Unique NameCN186126
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length806
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12816 contig Csv1_Contig12816:345..1150. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLB_ARATH (Reticulon-like protein B2 OS=Arabidopsis thaliana GN=RTNLB2 PE=1 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.966e-62
Identity = 122/179 (68.16%), Postives = 141/179 (78.77%), Query Frame = -3
Query:  271 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-LKDKKK 804
            ++KK+S GV GGAT  WV           L+CH +IVALAVLFLWSNA+ FI+KSPP+IPEV+IPEEP+LQLAS LR EINR    LREIASGRD+KKFLS IAGLWV+SI+G   +FLTL YI  VLL TVP+ Y+KYED+VDS+ EKA AE+KKQYAV DAKV SKIPR  LKDKKK
Sbjct:   92 KDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKKQYAVLDAKVFSKIPRGPLKDKKK 270          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLA_ARATH (Reticulon-like protein B1 OS=Arabidopsis thaliana GN=RTNLB1 PE=1 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.736e-61
Identity = 123/179 (68.72%), Postives = 138/179 (77.09%), Query Frame = -3
Query:  271 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-LKDKKK 804
            +NKK+S GVLGGATA WV           L+CH +IV LAVLFLWSNA+ FINKSPP+IPEV+IPEEP+LQLAS LR EINR F  LREIASGRDLKKFL  IAGLWV+SI+G   NFLTL YI  VLL TVP+ Y+KYED+VD   EKA  E+KKQYAV D KVLSKIP   LK+KKK
Sbjct:   96 KNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIELKKQYAVLDEKVLSKIPLGPLKNKKK 274          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLD_ARATH (Reticulon-like protein B4 OS=Arabidopsis thaliana GN=RTNLB4 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 3.064e-58
Identity = 116/182 (63.74%), Postives = 133/182 (73.08%), Query Frame = -3
Query:  271 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVL----SKIPRSLKDKKK 804
            RNKK+S GVLG  TA WV            +CH  I ALA LFLWSNA TFI+KS P IPEV+IPE+P+LQL S LR EINR   LLR IASG+D+KKF+ VIAGLWV+SI+GS  NFLTLFY   VLL T+PV+YEKYED+VD++ EKA  EIKKQYAV D KVL    SKIPR   +KKK
Sbjct:   75 RNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVLRKVISKIPRGALNKKK 256          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLC_ARATH (Reticulon-like protein B3 OS=Arabidopsis thaliana GN=RTNLB3 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 5.779e-57
Identity = 115/169 (68.05%), Postives = 129/169 (76.33%), Query Frame = -3
Query:  298 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKI 804
            RNKK+S GVLG AT  W+           L  H  I+ALAVLFLWS+ASTFI+KSP  IPEV+IPE+ VLQLAS LR EINR F +LR+IASGRDLKKFL VIAGLWV+S VGS CNFLTL YI  VLL T+PV+YEKYED+VD F EKA  EIKKQY  FD KVLSK+
Sbjct:   71 RNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKV 239          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLE_ARATH (Reticulon-like protein B5 OS=Arabidopsis thaliana GN=RTNLB5 PE=1 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 8.345e-56
Identity = 109/179 (60.89%), Postives = 136/179 (75.98%), Query Frame = -3
Query:  271 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIP-RSLKDKKK 804
            R+KK+S  VLG ATAIWV           L+CH  I+AL  LFLWSNA T INK+ P+IPE+++PEE  L +AS+LR E+N+AF +LR IA GRDLKKFL V+ GLW++S+VG+W NFLTL YI FV+LHTVP++YEK+ED+VD  +EKA  E++KQY VFD KVLSKIP  SLK K K
Sbjct:   75 RDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPIASLKAKAK 253          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLF_ARATH (Reticulon-like protein B6 OS=Arabidopsis thaliana GN=RTNLB6 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.574e-54
Identity = 109/177 (61.58%), Postives = 133/177 (75.14%), Query Frame = -3
Query:  277 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIP-RSLKDK 804
            R+KK+SA VLG ATAIWV           LVCH LI ALA LFL SNA  F+NK+PP+IPE++I EE  L + SALR E+N+AF +LR IA GRDLKKFL V+ GLW++S+VG+W NFLTL YI FV+LHTVP++YEK+ED+VD  +EK   E+KK Y VFD KVLSK+P  SLK K
Sbjct:   75 RDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKTPPKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDLKKFLMVVFGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSKLPVASLKAK 251          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLG_ARATH (Reticulon-like protein B7 OS=Arabidopsis thaliana GN=RTNLB7 PE=2 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 1.928e-44
Identity = 86/170 (50.59%), Postives = 118/170 (69.41%), Query Frame = -3
Query:  295 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIP 804
            R+KK++ G+L   T IW+            +C   I+ L + FLWSNA   +NKSP  + ++YIPE+P+LQ ASA+ FE+N AF  LR IA  RD+K F+  + GLW+VS++G+W +FL+L YI FVL+HTVP++YEKYED +D  +EKA  E+KK Y VF+AK LSKIP
Sbjct:   77 RDKKVTLGLLSAVTVIWLLFGFGGRRLLTSLCRGSILFLLLSFLWSNA---LNKSPENMMDIYIPEKPLLQAASAMTFELNCAFATLRSIALERDIKNFVMAVIGLWLVSVIGNWFSFLSLLYICFVLIHTVPMLYEKYEDEIDPIAEKAVIEMKKHYQVFEAKFLSKIP 243          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLH_ARATH (Reticulon-like protein B8 OS=Arabidopsis thaliana GN=RTNLB8 PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 8.675e-37
Identity = 78/178 (43.82%), Postives = 109/178 (61.24%), Query Frame = -3
Query:  271 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRSLKDKKK 804
            RNKKISA VL GATAIWV           LVC+ L++ +   F+WSNAS F+N+S  R+P + +P++   ++  A+  E+NR    L+++A   +LK+FL  + GLWV ++VGS CNFLT+ YI FV  HT+PV+YE+YED VD F +    +    Y   D   LS+IP      KK
Sbjct:   68 RNKKISASVLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLNRSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSMIMKFHSHYKKLDTGFLSRIPSGKFGLKK 245          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLI_ARATH (Reticulon-like protein B9 OS=Arabidopsis thaliana GN=RTNLB9 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.136e-28
Identity = 68/178 (38.20%), Postives = 101/178 (56.74%), Query Frame = -3
Query:  274 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPR-SLKDKK 804
            R  KI+A ++ G + +W            L+CH  + ++   F+WS AS F+N   P IPEV + E    QLA +     N+    L ++A GRD   F      L++VSI+G++ NF+ L +I FV + T+PV+YE YED VD+ + K   ++KK Y   D  VLSKIPR ++K+KK
Sbjct:   46 REPKIAATLVIGVSILWFLMEVVEYNFITLICHASMTSMLFFFIWSTASDFLNWERPLIPEVVLDESSFKQLARSFHVRFNQILTKLLDVACGRDPPLFFLTTISLYIVSIIGTYFNFVNLLFIGFVSMQTLPVMYEMYEDDVDTAAGKLMRKMKKLYKKVDTNVLSKIPRGTVKNKK 223          
BLAST of CN186126 vs. ExPASy Swiss-Prot
Match: RTNLJ_ARATH (Reticulon-like protein B10 OS=Arabidopsis thaliana GN=RTNLB10 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.588e-22
Identity = 55/169 (32.54%), Postives = 90/169 (53.25%), Query Frame = -3
Query:  298 RNKKISAGVLGGATAIWVXXXXXXXXXXXLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKI 804
            +N++    +LG  T +W             V +  ++++ +LFLW+ ++   N+  P++P + I EE V  +A A+R  IN    + REI  GR+ K+   V   LW VS VG++ NFLT+ Y+  VL   +P +YE+Y+D +D         I+ QY   D ++L KI
Sbjct:   21 KNRRGGFLLLGSTTLLWFLFEKCGYSFFPFVVNTQLLSVVILFLWAKSAILFNRPMPQLPNLEITEEFVFMVADAIRVWINTVLAVAREIYVGRNAKQLFRVSVVLWTVSFVGNFLNFLTILYLGVVLSLLIPFLYERYQDLIDEKLSLTHRVIQTQYRKIDERLLQKI 189          
The following BLAST results are available for this feature:
BLAST of CN186126 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
RTNLB_ARATH5.966e-6268.16Reticulon-like protein B2 OS=Arabidopsis thaliana ... [more]
RTNLA_ARATH1.736e-6168.72Reticulon-like protein B1 OS=Arabidopsis thaliana ... [more]
RTNLD_ARATH3.064e-5863.74Reticulon-like protein B4 OS=Arabidopsis thaliana ... [more]
RTNLC_ARATH5.779e-5768.05Reticulon-like protein B3 OS=Arabidopsis thaliana ... [more]
RTNLE_ARATH8.345e-5660.89Reticulon-like protein B5 OS=Arabidopsis thaliana ... [more]
RTNLF_ARATH1.574e-5461.58Reticulon-like protein B6 OS=Arabidopsis thaliana ... [more]
RTNLG_ARATH1.928e-4450.59Reticulon-like protein B7 OS=Arabidopsis thaliana ... [more]
RTNLH_ARATH8.675e-3743.82Reticulon-like protein B8 OS=Arabidopsis thaliana ... [more]
RTNLI_ARATH1.136e-2838.20Reticulon-like protein B9 OS=Arabidopsis thaliana ... [more]
RTNLJ_ARATH1.588e-2232.54Reticulon-like protein B10 OS=Arabidopsis thaliana... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G13_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G13, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186126 ID=CN186126|Name=CN186126|organism=Citrus sinensis|type=EST|length=806bp
TTTTTGTACAACCACTCTAATTGATAAAAAACATAATACCACATCAGCAT
AATACTCACACATATCCATGCAAATAGCTACGACATATGTAGCATAAACA
AGTACAAAATATCCATATTGTGAACCCAACCACCTCTAGAACAACAAAGG
AATAAAACAGGGTTCAAGCCAACACTGGATAACAGTTTCATAACACCTAG
ATAAAATACTTTCTACCAAATGTGTGTCAGAACCTAGCAAAGACCGCAAA
TTTATACCACCATTCTAAGCCTTCTTCTTGTCCTTCAATGACCTTGGTAT
CTTACTTAAGACCTTGGCATCAAAGACTGCATACTGCTTCTTGATCTCAG
CCCATGCCTTCTCAGAAAATGAATCCACCCGATCCTCATACTTCTCATAT
ATCACAGGCACAGTGTGAAGCAGTACAAAAACTATGTAGAACAAGGTCAA
GAAATTGCACCAGCTCCCCACAATCGACACAACCCACAAGCCAGCAATCA
CCGAGAGAAACTTCTTCAGATCTCTTCCAGATGCTATTTCCCTCAGAAGA
GGGAAGGCCCTATTGATCTCAAACCTAAGTGCAGAGGCCAACTGTAAAAC
TGGTTCCTCAGGGATATATACTTCTGGAATGCGTGGTGGAGACTTGTTAA
TGAAGGTGGAAGCATTAGACCACAAGAAAAGCACCGCAAGTGCAACAATC
AGGCAGTGACAGACAAGAGTTAGAAGGTGGTACTCAAGCAATTCAAAAAG
AACCCATATTGCAGTAGCCCCACCAAGTACTCCTGCTGAAATCTTCTTGT
TCCTCC
back to top