DC900178

Overview
NameDC900178
Unique NameDC900178
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length460
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900178_ssr74 microsatellite DC900178_ssr74:74..85. BLAST: Citrus ESTs to Prunus persica proteins V1
DC900178_ssr179 microsatellite DC900178_ssr179:179..190. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900178 vs. ExPASy Swiss-Prot
Match: OLEO1_SOYBN (P24 oleosin isoform A OS=Glycine max PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 3.002e-12
Identity = 31/47 (65.96%), Postives = 41/47 (87.23%), Query Frame = 2
Query:  245 FIICSPVLVPAALVTGLAIAGFLTSGAFGITALSSFSWMASFLRRTR 385
            F++ SPVLVPA +  GLA+AGFLTSGAFG+TALSSFSW+ +++R T+
Sbjct:   91 FVLFSPVLVPATVAIGLAVAGFLTSGAFGLTALSSFSWILNYIRETQ 137          
BLAST of DC900178 vs. ExPASy Swiss-Prot
Match: OLEO2_SOYBN (P24 oleosin isoform B OS=Glycine max PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.121e-12
Identity = 31/47 (65.96%), Postives = 40/47 (85.11%), Query Frame = 2
Query:  245 FIICSPVLVPAALVTGLAIAGFLTSGAFGITALSSFSWMASFLRRTR 385
            FII SPVL+PA +  GLA+AGFLTSG FG+TALSSFSW+ +++R T+
Sbjct:   90 FIIFSPVLIPATVAIGLAVAGFLTSGVFGLTALSSFSWILNYIRETQ 136          
BLAST of DC900178 vs. ExPASy Swiss-Prot
Match: OLEO2_ORYSJ (Oleosin 18 kDa OS=Oryza sativa subsp. japonica GN=OLE18 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.541e-11
Identity = 44/116 (37.93%), Postives = 59/116 (50.86%), Query Frame = 2
Query:   92 DAIKGMLPERTPSKSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIICSPVLVPAALVTGLAIAGFLTSGAFGITALSSFSWMASFLRRT--RAPG---QAKRRVLGTA 424
            + +KG+LPE+ PS SQ                                   F+I SPVLVPAAL+ GLA+AGFLTSGA G+  LSS +++A+  R+   R P    QA+RR+   A
Sbjct:   20 ETVKGILPEKAPSASQALTVATLFPLGGLLLVLSGLALAASVVGLAVATPVFLIFSPVLVPAALLIGLAVAGFLTSGALGLGGLSSLTFLANTARQAFQRTPDYVEQARRRMAEAA 135          
BLAST of DC900178 vs. ExPASy Swiss-Prot
Match: OLEO2_ORYSI (Oleosin 18 kDa OS=Oryza sativa subsp. indica GN=OLE18 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.541e-11
Identity = 44/116 (37.93%), Postives = 59/116 (50.86%), Query Frame = 2
Query:   92 DAIKGMLPERTPSKSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIICSPVLVPAALVTGLAIAGFLTSGAFGITALSSFSWMASFLRRT--RAPG---QAKRRVLGTA 424
            + +KG+LPE+ PS SQ                                   F+I SPVLVPAAL+ GLA+AGFLTSGA G+  LSS +++A+  R+   R P    QA+RR+   A
Sbjct:   20 ETVKGILPEKAPSASQALTVATLFPLGGLLLVLSGLALAASVVGLAVATPVFLIFSPVLVPAALLIGLAVAGFLTSGALGLGGLSSLTFLANTARQAFQRTPDYVEQARRRMAEAA 135          
BLAST of DC900178 vs. ExPASy Swiss-Prot
Match: OLEO2_ARATH (Oleosin 21.2 kDa OS=Arabidopsis thaliana GN=At5g40420 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.541e-11
Identity = 43/114 (37.72%), Postives = 54/114 (47.37%), Query Frame = 2
Query:  101 KGMLPERTPSKSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIICSPVLVPAALVTGLAIAGFLTSGAFGITALSSFSWMASFLRRTR--APGQ---AKRRVLGTAG 427
            K M+PE  PS +Q                                   F++ SPV+VPAAL  GLA+ GFL SG FG+T LSS SW+ ++LR TR   P Q   AKRR+    G
Sbjct:   41 KSMMPESGPSSTQVLSLLIGVPVVGSLLALAGLLLAGSVIGLMVALPLFLLFSPVIVPAALTIGLAMTGFLASGMFGLTGLSSISWVMNYLRGTRRTVPEQLEYAKRRMADAVG 154          
The following BLAST results are available for this feature:
BLAST of DC900178 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
OLEO1_SOYBN3.002e-1265.96P24 oleosin isoform A OS=Glycine max PE=2 SV=2[more]
OLEO2_SOYBN5.121e-1265.96P24 oleosin isoform B OS=Glycine max PE=2 SV=1[more]
OLEO2_ORYSJ2.541e-1137.93Oleosin 18 kDa OS=Oryza sativa subsp. japonica GN=... [more]
OLEO2_ORYSI2.541e-1137.93Oleosin 18 kDa OS=Oryza sativa subsp. indica GN=OL... [more]
OLEO2_ARATH2.541e-1137.72Oleosin 21.2 kDa OS=Arabidopsis thaliana GN=At5g40... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900178 VSS Citrus sinensis cDNA clone VS28204 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900178 ID=DC900178|Name=DC900178|organism=Citrus sinensis|type=EST|length=460bp
AGTACTGCAAAAGCAAAAACACAACAAAATCAGTTCAATGGCCGAGTCAC
GCCAGACCCAGCACTACCAGCAACAGCAGCAGCAGCCAAGTGATGCCATC
AAAGGCATGTTACCCGAAAGGACACCATCTAAATCACAACTTCTTGCTGT
CGTTACCCTTCTGCCTGTTGGTGGCACTCTCCTCCTCCTCTCTGGTCTCA
CGTTGGCCGGGACCCTCACTTGCCTCGCTCTCGCCACCCCGCTTTTTATA
ATTTGCAGCCCGGTTTTGGTGCCCGCAGCCCTCGTCACTGGCTTGGCCAT
CGCCGGTTTCTTGACTTCCGGTGCTTTTGGAATAACTGCGCTCTCCTCCT
TCTCTTGGATGGCCAGTTTTCTAAGGAGAACGCGGGCCCCTGGACAGGCG
AAGCGGCGCGTGCTGGGCACGGCGGGTGGCCAGAGGTAGGAACGCAATAC
CACAAGGCAG
back to top