DC900177

Overview
NameDC900177
Unique NameDC900177
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length754
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10835 contig Csv1_Contig10835:1299..2052. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900177 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.039e-57
Identity = 112/194 (57.73%), Postives = 140/194 (72.16%), Query Frame = 3
Query:    3 TAYSTYGNGKTLLDISTGQPSTPFDFGAGHVDPVAALDPGLVYDATVQDYLDFLCALDYSSFEIKQATNRDFACLSSKTYSLGDVNYPSFSVPFETASGTWGGVGAPSTVKYTRTLTNVGTPTTYKASVSSQSTSVKILVEPESLSFSRQYEKKSYVVTFTA-SSMPSGTTSFARLQWSDGKHVVGSPIAFSWT 581
            TAY TY +GK LLDI+TG+PSTPFD GAGHV P  A +PGL+YD T +DYL FLCAL+Y+S +I+  + R++ C  SK+YS+ D+NYPSF+V  +       GVGA    KYTRT+T+VG   TY   V+S++T VKI VEP  L+F    EKKSY VTFT  SS PSG+ SF  ++WSDGKHVVGSP+A SWT
Sbjct:  574 TAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVD-------GVGA---YKYTRTVTSVGGAGTYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIEWSDGKHVVGSPVAISWT 757          
BLAST of DC900177 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 9.190e-22
Identity = 65/173 (37.57%), Postives = 94/173 (54.34%), Query Frame = 3
Query:   60 PSTPFDFGAGHVDPVAALDPGLVYDATVQDYLDFLCALDYSSFEIKQATNRDFACLSSKTYSLGDVNYPSFSVPFETASGTWGGVGAPSTVKYTRTLTNVG-TPTTYKASVSSQSTSVKILVEPESLSFSRQYEKKSYVVTFTASSMPSGTTSFARLQWSDGKHVVGSPIAFS 575
            P   F +G+GHV+P+ A+ PGLVYDA   DY+ FLC   Y++  +++ T    AC S  T  + D+NYPSF +   + S T+          + RTLT+V    +TY+A +S+    + I V P  LSF+   ++KS+ +T   S    G    A L WSDG H V SPI  +
Sbjct:  567 PQAEFAYGSGHVNPLKAVRPGLVYDANESDYVKFLCGQGYNTQAVRRITGDYSACTSGNTGRVWDLNYPSFGLSV-SPSQTFNQY-------FNRTLTSVAPQASTYRAMISAPQ-GLTISVNPNVLSFNGLGDRKSFTLTVRGSI--KGFVVSASLVWSDGVHYVRSPITIT 728          
BLAST of DC900177 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.518e-16
Identity = 54/167 (32.34%), Postives = 78/167 (46.71%), Query Frame = 3
Query:   72 FDFGAGHVDPVAALDPGLVYDATVQDYLDFLCALDYSSFEIKQATNRDFACLSSKTYSLG--DVNYPSFSVPFETASGTWGGVGAPSTVKYTRTLTNVGTPTTYKASVSSQSTSVKILVEPESLSFSRQYEKKSYVVTFTASSMPSGTTSFARLQWSDGKHVVGSPI 566
            F +G G ++P  A  PGLVYD     Y+ FLC   Y++  +           SS    LG   +NYP+  +   +A  +   V       + R +TNVG P++   +       V+I VEP+SLSFS+  +K+S+ V   A  M  G      L W   +H V SPI
Sbjct:  582 FAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGTRSVSCSSIVPGLGHDSLNYPTIQLTLRSAKTSTLAV-------FRRRVTNVGPPSSVYTATVRAPKGVEITVEPQSLSFSKASQKRSFKVVVKAKQMTPGKIVSGLLVWKSPRHSVRSPI 741          
The following BLAST results are available for this feature:
BLAST of DC900177 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SUBL_ARATH1.039e-5757.73Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
CUCM1_CUCME9.190e-2237.57Cucumisin OS=Cucumis melo PE=1 SV=1[more]
XSP1_ARATH1.518e-1632.34Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900177 VSS Citrus sinensis cDNA clone VS28203 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900177 ID=DC900177|Name=DC900177|organism=Citrus sinensis|type=EST|length=754bp
CTACAGCCTACTCAACATATGGCAATGGCAAAACCCTACTAGACATTTCC
ACTGGACAACCATCAACACCATTCGACTTTGGCGCTGGACATGTAGATCC
TGTAGCAGCTCTTGATCCTGGCCTTGTCTATGATGCCACTGTCCAAGACT
ACCTAGACTTCCTCTGTGCCTTAGACTATAGCTCGTTTGAGATTAAGCAA
GCTACAAACAGAGACTTCGCCTGCCTGTCAAGCAAAACATACAGCCTGGG
TGATGTTAATTACCCATCTTTCTCTGTTCCATTTGAAACAGCATCAGGTA
CATGGGGTGGTGTTGGCGCGCCAAGCACTGTGAAATACACTAGGACTCTA
ACAAATGTGGGCACTCCGACGACATACAAGGCATCTGTGTCTTCACAATC
TACATCAGTGAAGATCTTAGTTGAACCAGAATCACTGAGCTTCAGTAGAC
AATATGAGAAAAAGAGTTATGTGGTGACATTCACGGCTAGTTCTATGCCG
TCAGGTACTACCAGCTTTGCTCGTCTCCAGTGGTCTGATGGGAAACATGT
GGTTGGAAGTCCAATAGCTTTCAGCTGGACATGATCATGGTAGCTACTAG
CATTTAATAATTGGTCTAATAACTAAATATAGGCCACAAAGTCCCAGACT
TAAATAATGCTTCACTCAGTCTATTGGACATTTGTGTGGCACCTTTGCTT
GNGTTCCAGCAACTGAGTAGCACAGCCCTTGCTTTGTTATCAGTAGATTG
AAAG
back to top