DC900176

Overview
NameDC900176
Unique NameDC900176
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length659
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: PA2G4_MOUSE (Proliferation-associated protein 2G4 OS=Mus musculus GN=Pa2g4 PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 2.088e-29
Identity = 61/120 (50.83%), Postives = 89/120 (74.17%), Query Frame = 3
Query:  159 EREEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDET-VLQEGDMIKIDLGCHIDGFIAVVA 515
            E E++E  +    VVTKYK   +IAN+ L+ +V     GV ++ LCEKGD+ I E+TG ++K  +K++++G+AFP+ +SVNN +CHFSPL SD+  +L+EGD++KIDLG H+DGFIA VA
Sbjct:    4 EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA 122          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: PA2G4_HUMAN (Proliferation-associated protein 2G4 OS=Homo sapiens GN=PA2G4 PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 2.088e-29
Identity = 61/120 (50.83%), Postives = 89/120 (74.17%), Query Frame = 3
Query:  159 EREEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDET-VLQEGDMIKIDLGCHIDGFIAVVA 515
            E E++E  +    VVTKYK   +IAN+ L+ +V     GV ++ LCEKGD+ I E+TG ++K  +K++++G+AFP+ +SVNN +CHFSPL SD+  +L+EGD++KIDLG H+DGFIA VA
Sbjct:    4 EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA 122          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: PRLA_DICDI (Proliferation-associated protein A OS=Dictyostelium discoideum GN=prlA PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 8.773e-28
Identity = 61/129 (47.29%), Postives = 88/129 (68.22%), Query Frame = 3
Query:  147 MSDDEREEKEL------DLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFIAVVA 515
            MS+ ++E KE       DL++P VV  Y +A  IAN A++ V+S+C  G  +VD+C+ GD FI  +    +   +K +E+G+AFP+CVSVNN + HFSPL  +   L++GD++KIDLGCHIDG+IAV A
Sbjct:    1 MSNKDQEIKEEAPVAIEDLSNPVVVDSYNAAGIIANNAIKHVISKCVVGALVVDICQYGDDFIEAEAAKTFTK-RKNLEKGIAFPTCVSVNNCVGHFSPLKGNTRTLKQGDVVKIDLGCHIDGYIAVGA 128          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: CDB4_SCHPO (Curved DNA-binding protein OS=Schizosaccharomyces pombe GN=cdb4 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 6.089e-21
Identity = 50/117 (42.74%), Postives = 72/117 (61.54%), Query Frame = 3
Query:  174 ELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASD---ETVLQEGDMIKIDLGCHIDGFIAVVA 515
            +  L++PE V KYK A E++   ++ VV  C+PG KI D+C +GD  + E    +Y+   K   +G+AFP+ VS N+   H SPL SD      L+ GD++KI LG HIDGF ++VA
Sbjct:   13 DYSLSNPETVNKYKIAGEVSQNVIKKVVELCQPGAKIYDICVRGDELLNEAIKKVYRT--KDAYKGIAFPTAVSPNDMAAHLSPLKSDPEANLALKSGDVVKILLGAHIDGFASLVA 127          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: AMPM2_MOUSE (Methionine aminopeptidase 2 OS=Mus musculus GN=Metap2 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.478e-14
Identity = 48/136 (35.29%), Postives = 73/136 (53.68%), Query Frame = 3
Query:  165 EEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKK-IERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFIAVVAPSCLRMSLYRQAADVLLS 569
            E+K LD  S E+   ++ AAE   +  + V+S  KPG+ ++++CEK +   R       K +K+  +  G+AFP+  S+NN   H++P A D TVLQ  D+ KID G HI G I      C     +    D+LL+
Sbjct:  154 EKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSR-------KLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRII----DCAFTVTFNPKYDILLT 278          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: AMPM2_RAT (Methionine aminopeptidase 2 OS=Rattus norvegicus GN=Metap2 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.236e-14
Identity = 48/135 (35.56%), Postives = 72/135 (53.33%), Query Frame = 3
Query:  165 EEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKK-IERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFIAVVAPSCLRMSLYRQAADVLL 566
            E+K LD  S E+   ++ AAE   +  + V+S  KPG+ ++++CEK +   R       K +K+  +  G+AFP+  S+NN   H++P A D TVLQ  D+ KID G HI G I      C     +    D+LL
Sbjct:  154 EKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSR-------KLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRII----DCAFTVTFNPKYDILL 277          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: AMPM2_BOVIN (Methionine aminopeptidase 2 OS=Bos taurus GN=METAP2 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.236e-14
Identity = 44/114 (38.60%), Postives = 66/114 (57.89%), Query Frame = 3
Query:  165 EEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKK-IERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFI 503
            E+K LD  S E+   ++ AAE   +  + V+S  KPG+ ++++CEK +   R       K +K+  +  G+AFP+  S+NN   H++P A D TVLQ  D+ KID G HI G I
Sbjct:  153 EKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKMEDCSR-------KLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRI 259          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: AMPM2_HUMAN (Methionine aminopeptidase 2 OS=Homo sapiens GN=METAP2 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.227e-14
Identity = 44/114 (38.60%), Postives = 66/114 (57.89%), Query Frame = 3
Query:  165 EEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKK-IERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFI 503
            E+K LD  S E+   ++ AAE   +  + V+S  KPG+ ++++CEK +   R       K +K+  +  G+AFP+  S+NN   H++P A D TVLQ  D+ KID G HI G I
Sbjct:  154 EKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSR-------KLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRI 260          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: AMP2A_ARATH (Methionine aminopeptidase 2A OS=Arabidopsis thaliana GN=MAP2A PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.230e-13
Identity = 37/113 (32.74%), Postives = 67/113 (59.29%), Query Frame = 3
Query:  165 EEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFI 503
            E++E++     +    + AAE+  +  + + S  KPG+ ++DLCE  ++ +R+         +  ++ G+AFP+  S+NN   H++P + D+TVLQ  D++K+D G HIDG I
Sbjct:  117 EKREMERLQKPIYNSLRQAAEVHRQVRKYMRSILKPGMLMIDLCETLENTVRKLIS------ENGLQAGIAFPTGCSLNNVAAHWTPNSGDKTVLQYDDVMKLDFGTHIDGHI 223          
BLAST of DC900176 vs. ExPASy Swiss-Prot
Match: AMPM_PYRHO (Methionine aminopeptidase OS=Pyrococcus horikoshii GN=map PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.606e-13
Identity = 44/105 (41.90%), Postives = 59/105 (56.19%), Query Frame = 3
Query:  201 VTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFIAVVA 515
            V K   A +IA K  +  V   KPGV +++L EK +S I E  G              AFP+ +S+N    H++P   D+TVL+EGD +KIDLG HIDG+IA  A
Sbjct:    3 VDKLIEAGKIAKKVREEAVKLAKPGVSLLELAEKIESRIVELGGKP------------AFPANLSLNEVAAHYTPYKGDQTVLKEGDYLKIDLGVHIDGYIADTA 95          
The following BLAST results are available for this feature:
BLAST of DC900176 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
PA2G4_MOUSE2.088e-2950.83Proliferation-associated protein 2G4 OS=Mus muscul... [more]
PA2G4_HUMAN2.088e-2950.83Proliferation-associated protein 2G4 OS=Homo sapie... [more]
PRLA_DICDI8.773e-2847.29Proliferation-associated protein A OS=Dictyosteliu... [more]
CDB4_SCHPO6.089e-2142.74Curved DNA-binding protein OS=Schizosaccharomyces ... [more]
AMPM2_MOUSE2.478e-1435.29Methionine aminopeptidase 2 OS=Mus musculus GN=Met... [more]
AMPM2_RAT3.236e-1435.56Methionine aminopeptidase 2 OS=Rattus norvegicus G... [more]
AMPM2_BOVIN3.236e-1438.60Methionine aminopeptidase 2 OS=Bos taurus GN=METAP... [more]
AMPM2_HUMAN4.227e-1438.60Methionine aminopeptidase 2 OS=Homo sapiens GN=MET... [more]
AMP2A_ARATH1.230e-1332.74Methionine aminopeptidase 2A OS=Arabidopsis thalia... [more]
AMPM_PYRHO1.606e-1341.90Methionine aminopeptidase OS=Pyrococcus horikoshii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900176 VSS Citrus sinensis cDNA clone VS28202 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900176 ID=DC900176|Name=DC900176|organism=Citrus sinensis|type=EST|length=659bp
CCCTATCGAGCCACCTCTTCAGTCTTCACCCTCTTTCTCTCTATCTCGTA
TTCTATTTTTTTATCTTTGCAGTACCCTAGCTTCACCGCCGTCACCGTCA
GTTTATCACAATTGTTTGGTAGATTTTTTCTACAAAAATCAAAACGATGT
CGGACGATGAAAGGGAGGAGAAGGAGTTGGATCTCACTTCTCCTGAAGTT
GTCACCAAATACAAAAGCGCTGCTGAGATCGCCAATAAGGCGTTGCAGTT
GGTAGTATCAGAATGCAAACCCGGTGTTAAGATTGTTGACCTTTGTGAGA
AGGGAGATTCATTTATTAGAGAACAAACCGGCAACATGTACAAGAATGTA
AAGAAGAAGATCGAGAGGGGCGTTGCATTCCCAAGTTGTGTTTCTGTTAA
CAACACACTCTGTCATTTTTCACCACTTGCAAGTGATGAGACAGTCTTGC
AAGAAGGAGACATGATCAAGATTGATTTGGGATGTCACATAGATGGGTTT
ATTGCTGTAGTTGCACCCTCATGTCTCAGGATGAGCCTGTACAGGCAGGC
AGCTGATGTATTGCTGAGCAATCTGCTGCTGAGGTGCTGAGCTGTAGGCC
GGAAGAGACAAGATGTACAGAGCATCAGAGTACTGTGATTATGAGATGTG
AGGGTCTAG
back to top