CN186122

Overview
NameCN186122
Unique NameCN186122
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length838
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5755 contig Csv1_Contig5755:284..1120. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC68_ORYSJ (NAC domain-containing protein 68 OS=Oryza sativa subsp. japonica GN=NAC68 PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 5.256e-48
Identity = 96/162 (59.26%), Postives = 109/162 (67.28%), Query Frame = -2
Query:  358 LRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDVA---QERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAANAPQKKNFAQTPAVATDNWVLCRIFLKK 834
            L LPPGFRFHPTDEELVV YL RK+   PLP  II EVD+ K DPWDLP       +E YFF+ R+ KYPNG+R NRA G GYWKATG DK +A     + VG+KK LVFY GK P G +TDWIMHEYRL  A  AP  K  +Q      D WVLCR++ KK
Sbjct:   19 LNLPPGFRFHPTDEELVVHYLCRKVARQPLPVPIIAEVDLYKLDPWDLPEKALFGRKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATGADKPVAPKGSARTVGIKKALVFYSGKAPRGVKTDWIMHEYRLADADRAPGGKKGSQ----KLDEWVLCRLYNKK 176          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC29_ARATH (NAC domain-containing protein 29 OS=Arabidopsis thaliana GN=NAC029 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.608e-47
Identity = 97/163 (59.51%), Postives = 112/163 (68.71%), Query Frame = -2
Query:  349 LPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDV---AQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAANAPQKKNFAQTPAVATDNWVLCRIFLKKRGA 828
            LPPGFRFHPTDEEL+V YL+ +  + P P SIIPEVD+ K DPW LP        E YFFS RE KYPNG R NRA  SGYWKATG DK I +   N  VG+KK LVFY+G+PP G +TDWIMHEYRL  +  A  K+N     ++  D WVLCRI+ KKRGA
Sbjct:    9 LPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSN--VGVKKALVFYKGRPPKGIKTDWIMHEYRLHDSRKASTKRN----GSMRLDEWVLCRIY-KKRGA 164          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC18_ARATH (NAC domain-containing protein 18 OS=Arabidopsis thaliana GN=NAC018 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.096e-45
Identity = 96/174 (55.17%), Postives = 116/174 (66.67%), Query Frame = -2
Query:  343 LPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDVA---QERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATS--RGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAANAP-------QKKNFAQTPAVATDNWVLCRIFLKKRGAKS 828
            LPPGFRFHPTDEELV+ YLKRK  + PLP +II +VD+ K DPW+LP   +   QE YFFS R+ KYPNG R NRA  SGYWKATG DK + ++   G++ VG+KK LVFY GKPP G ++DWIMHEYRL    N P        KKN     ++  D+WVLCRI+ K     S
Sbjct:   17 LPPGFRFHPTDEELVIHYLKRKADSVPLPVAIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVISTGGGGSKKVGVKKALVFYSGKPPKGVKSDWIMHEYRLTD--NKPTHICDFGNKKN-----SLRLDDWVLCRIYKKNNSTAS 183          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC71_ORYSJ (NAC domain-containing protein 71 OS=Oryza sativa subsp. japonica GN=NAC71 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.583e-44
Identity = 92/164 (56.10%), Postives = 113/164 (68.90%), Query Frame = -2
Query:  358 LRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDV---AQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRL--VTAANAPQKKNFAQTPAVATDNWVLCRIFLKK 834
            L+LPPGFRFHPTD+ELV+ YL RK    PL A +I EVD+ K +PWDLP       +E YFFS R+ KYPNG R NRA G+GYWKATG DK + + R    V +KK LVFY GKPP G +T+WIMHEYRL  V  + A +K + +   A+  D+WVLCRI+ KK
Sbjct:    7 LQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEVDLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSPRA---VAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVLCRIYNKK 167          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC48_ORYSJ (NAC domain-containing protein 48 OS=Oryza sativa subsp. japonica GN=NAC48 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.699e-44
Identity = 91/183 (49.73%), Postives = 114/183 (62.30%), Query Frame = -2
Query:  295 LRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDV---AQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAANAPQKKNFAQTPAVATDNWVLCRIFLKKRGAKSEDEETCTEIGGTRANG 834
            L+LPPGFRFHPTDEELV+ YL R+    P+   II E+D+ K DPW LP       +E YFFS R+ KYPNG+R NRA GSGYWKATG DK + + +    V +KK LVFY GK P G +T+WIMHEYRL     + +KKN     ++  D+WVLCRI+ KK G +          G   + G
Sbjct:    7 LQLPPGFRFHPTDEELVMHYLCRRCAGLPIAVPIIAEIDLYKFDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGSPKP---VAIKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSARKKN-----SLRLDDWVLCRIYNKKGGLEKPPAAAVAAAGMVSSGG 181          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC2_ARATH (NAC domain-containing protein 2 OS=Arabidopsis thaliana GN=NAC002 PE=2 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 6.014e-44
Identity = 97/199 (48.74%), Postives = 123/199 (61.81%), Query Frame = -2
Query:  256 VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDV---AQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAANAPQKKNFAQTPAVATDNWVLCRIFLKKRGAKSEDEETCTEIGGTRANGPKP--VFYDFMRKEE 837
            +L+LPPGFRFHPTDEELV+ YL RK  +  +   II E+D+ K DPW+LPG      +E YFFS R+ KYPNG+R NR+ GSGYWKATG DK I   +    VG+KK LVFY GK P G +T+WIMHEYRL     + +KK      ++  D+WVLCRI+ KK              G T   GP P  V+ D + +E+
Sbjct:    4 LLQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDLYKYDPWELPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLPKP---VGIKKALVFYAGKAPKGEKTNWIMHEYRLADVDRSVRKKK----NSLRLDDWVLCRIYNKK--------------GATERRGPPPPVVYGDEIMEEK 181          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC19_ARATH (NAC domain-containing protein 19 OS=Arabidopsis thaliana GN=NAC019 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.300e-42
Identity = 89/168 (52.98%), Postives = 111/168 (66.07%), Query Frame = -2
Query:  340 LRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDV---AQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAANAPQKKNFAQTPAVATDNWVLCRIFLKKRGAKSE 834
            L LPPGFRF+PTDEEL+VQYL RK         +I E+D+ K DPW LP       +E YFFS R+ KYPNG+R NR  GSGYWKATG DK I+T    Q VG+KK LVFY GK P G++T+WIMHEYRL+     P ++N     +   D+WVLCRI+ K+  A+ +
Sbjct:   12 LSLPPGFRFYPTDEELMVQYLCRKAAGYDFSLQLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIISTE--GQRVGIKKALVFYIGKAPKGTKTNWIMHEYRLI----EPSRRN----GSTKLDDWVLCRIYKKQSSAQKQ 169          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC9_ARATH (Putative NAC domain-containing protein 9 OS=Arabidopsis thaliana GN=NAC009 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.310e-42
Identity = 81/160 (50.62%), Postives = 109/160 (68.12%), Query Frame = -2
Query:  361 LPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDVA---QERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAAN-APQKKNFAQTPAVATDNWVLCRIFLK 828
            L PGFRFHPTDEELV  YLKRK+   PL   +I ++D+ K DPWDLP       +E YF+  R+ KY N +R NR TG+G+WKATG D+ I +S GN+ +G+KK+LVFY+G+   G +TDW+MHE+RL + +  +P  K F  +P    D+W +CRIF K
Sbjct:   16 LLPGFRFHPTDEELVSFYLKRKVQHNPLSIELIRQLDIYKYDPWDLPKFAMTGEKEWYFYCPRDRKYRNSSRPNRVTGAGFWKATGTDRPIYSSEGNKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRLPSLSEPSPPSKRFFDSPVSPNDSWAICRIFKK 175          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC72_ARATH (NAC domain-containing protein 72 OS=Arabidopsis thaliana GN=NAC072 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.629e-42
Identity = 87/168 (51.79%), Postives = 111/168 (66.07%), Query Frame = -2
Query:  340 LRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDV---AQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAANAPQKKNFAQTPAVATDNWVLCRIFLKKRGAKSE 834
            L LPPGFRF+PTDEEL+VQYL RK+        +I ++D+ K DPWDLP       +E YFFS R+ KYPNG+R NR  GSGYWKATG DK I T+ G + VG+KK LVFY GK P G++T+WIMHEYRL+  + +              D+WVLCRI+ K  G++ +
Sbjct:   12 LSLPPGFRFYPTDEELLVQYLCRKVAGYHFSLQVIGDIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDK-IITADGRR-VGIKKALVFYAGKAPKGTKTNWIMHEYRLIEHSRSHGSSKL--------DDWVLCRIYKKTSGSQRQ 169          
BLAST of CN186122 vs. ExPASy Swiss-Prot
Match: NAC67_ORYSJ (NAC domain-containing protein 67 OS=Oryza sativa subsp. japonica GN=NAC67 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.139e-41
Identity = 88/176 (50.00%), Postives = 108/176 (61.36%), Query Frame = -2
Query:  331 LRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEVDVCKSDPWDLPGDV---AQERYFFSTREAKYPNGNRSNRATGSGYWKATGLDKQIATSRGNQIVGMKKTLVFYRGKPPHGSRTDWIMHEYRLVTAANAPQKKNFAQTPAVATDNWVLCRIFLKKR-----GAKSEDEE 834
            L LPPGFRFHPTDEELV  YL  +      P  II E+D+ + DPWDLP       +E YFF+ R+ KYPNG+R NRA  SGYWKATG DK +      +  G+KK LVFY GKPP G +T+WIMHEYRL     A      A   A+  D+WVLCR++ KK       ++ E+EE
Sbjct:   15 LNLPPGFRFHPTDEELVAHYLCPRAAGRAAPVPIIAELDLYRHDPWDLPHRALFGRREWYFFTPRDRKYPNGSRPNRAAASGYWKATGADKPVL--HNGRTAGIKKALVFYHGKPPRGVKTEWIMHEYRLAKKGGAAAA---AGAGALRLDDWVLCRLYNKKNEWEKMQSRKEEEE 185          
The following BLAST results are available for this feature:
BLAST of CN186122 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
NAC68_ORYSJ5.256e-4859.26NAC domain-containing protein 68 OS=Oryza sativa s... [more]
NAC29_ARATH2.608e-4759.51NAC domain-containing protein 29 OS=Arabidopsis th... [more]
NAC18_ARATH1.096e-4555.17NAC domain-containing protein 18 OS=Arabidopsis th... [more]
NAC71_ORYSJ1.583e-4456.10NAC domain-containing protein 71 OS=Oryza sativa s... [more]
NAC48_ORYSJ2.699e-4449.73NAC domain-containing protein 48 OS=Oryza sativa s... [more]
NAC2_ARATH6.014e-4448.74NAC domain-containing protein 2 OS=Arabidopsis tha... [more]
NAC19_ARATH3.300e-4252.98NAC domain-containing protein 19 OS=Arabidopsis th... [more]
NAC9_ARATH4.310e-4250.63Putative NAC domain-containing protein 9 OS=Arabid... [more]
NAC72_ARATH5.629e-4251.79NAC domain-containing protein 72 OS=Arabidopsis th... [more]
NAC67_ORYSJ2.139e-4150.00NAC domain-containing protein 67 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G11_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186122 ID=CN186122|Name=CN186122|organism=Citrus sinensis|type=EST|length=838bp
GACAACATTAGATTACTTGATGATGATGGCTAATTGGGTATTCTGCATTT
TTCTAATCAGAAACGCCAATTACTTGTACAGAACACTAATTAAAAAGAGA
GAAATTATTGAAAATGTTTACTGCTGTTTTCTTCTAAAGTAAGGGAAGCT
ATTGCAACTACTCTCTTCATGATCGTCTGATTCATTTGAAGAAACTTCAG
TGACTCCACTTGAGCCTGAGGAAGATGAAGTTGGAACAAGGTTCAAGTCA
GCCCTTTCCTCCTTTCTCATAAAATCATAAAAAACCGGCTTGGGCCCGTT
AGCCCTGGTTCCTCCAATTTCGGTGCACGTTTCCTCATCCTCACTCTTGG
CTCCTCTTTTCTTCAAAAAGATGCGGCATAGAACCCAATTGTCCGTTGCC
ACAGCTGGGGTCTGGGCGAAGTTTTTCTTTTGAGGGGCATTGGCAGCAGT
AACAAGGCGGTATTCATGCATGATCCAATCAGTCCTAGAGCCGTGTGGTG
GCTTGCCTCTATAAAAAACGAGAGTTTTTTTCATTCCCACGATTTGGTTG
CCCCTGGAAGTCGCAATTTGCTTGTCAAGCCCAGTTGCCTTCCAATAACC
AGACCCCGTGGCCCTGTTCGATCTGTTCCCGTTTGGGTACTTAGCTTCCC
TTGTGCTGAAAAAATACCTCTCTTGCGCCACATCACCTGGCAAATCCCAA
GGATCAGACTTGCAAACATCAACTTCAGGAATTATGGAAGCGGGCAAGGG
GCAGGCAAAAATCTTGCGCTTCAAGTACTGAACAACAAGTTCTTCGTCCG
TAGGATGGAACCGGAATCCCGGAGGCAGTCTCAGCACA
back to top