CN186121

Overview
NameCN186121
Unique NameCN186121
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length707
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12567 contig Csv1_Contig12567:64..770. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 4.005e-109
Identity = 199/203 (98.03%), Postives = 199/203 (98.03%), Query Frame = 3
Query:   99 FAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW 707
            FAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW
Sbjct:    9 FAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW 211          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 7.606e-84
Identity = 153/189 (80.95%), Postives = 169/189 (89.42%), Query Frame = 3
Query:  141 SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW 707
            SSF+G P++PS +R+QP K+    ++S+S + SPPYDL  F FDPIKESIVSREMTRRYM DMITYADTD    GAGS+GL C YELSKNP++Q+AIIEQSVSPGGGAWLGGQLFS MVVRKPAH+FLDELGI+YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW
Sbjct:   20 SSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIEYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW 207          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 8.703e-80
Identity = 151/201 (75.12%), Postives = 172/201 (85.57%), Query Frame = 3
Query:  108 SVSSTT-NKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW 707
            S+SST   +LFDSSFHG+ +S + + +      +P + S+ A+ +  YDLN F FDPIKESIVSREMTRRYMTDMITYA+TD    GAGSAGLS AYE+SKNPN+Q+AIIEQSVSPGGGAWLGGQLFSAM+VRKPAH+FLDE+G+ YDEQD YVV+KHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG RVGGVVTNW
Sbjct:    9 SLSSTKPQRLFDSSFHGSAISAAPISI----GLKPRSFSVRATTAG-YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNW 204          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 2.453e-74
Identity = 146/209 (69.86%), Postives = 166/209 (79.43%), Query Frame = 3
Query:  114 SSTTNKLFDSSFHGAPMSPSLLRLQPIK----------SSRPNNLSISASAS-PPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW 707
            ++  + L  SSF G+ + P+  R  P             + P   S+S S+S PPYDL +F+F PIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSK+P + IAI+EQSVSPGGGAWLGGQLFSAMVVRKPAH+FLDELG+ YDE ++YVVIKHAALFTST+MS LLARPNVKLFNAVA EDLIV+GGRVGGVVTNW
Sbjct:    3 TAAASSLLKSSFAGSRL-PAATRTTPASLVVATGPRGAGAGPICASMSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTSTVMSLLLARPNVKLFNAVAVEDLIVRGGRVGGVVTNW 210          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.712e-73
Identity = 142/207 (68.60%), Postives = 164/207 (79.23%), Query Frame = 3
Query:  114 SSTTNKLFDSSFHGAPMSPSLLRLQ---------PIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNW 707
            ++  + L  SSF G+ + PS  R           P     P   SIS S +PPYDL +F+F PIKESIVSREMTRRYMTDMIT+ADTD    GAGSAGLSCAYELSK+P + +AI+EQSVSPGGGAWLGGQLFSAMVVR+PAH+FLDELG+ YDE ++YVV+KHAALFTST+MS+LLARPNVKLFNAVA EDLIV+ GRVGGVVTNW
Sbjct:    3 TTAASSLLKSSFAGSRL-PSATRTTTPSSVAVATPRAGGGPIRASIS-SPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKHAALFTSTVMSRLLARPNVKLFNAVAVEDLIVRRGRVGGVVTNW 207          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 1.003e-51
Identity = 103/167 (61.68%), Postives = 132/167 (79.04%), Query Frame = 3
Query:  228 ASASPPYDLN-TFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGG-----RVGGVVTNW 707
            + A P Y L+ +F F PI+ES VSR MTRRY +D+  YA++D    GAGSAGL+ AY + ++ P+++IAIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+G+ Y+++ +YVV+KHAALFTST+M++ LA PNVKLFNA A EDLIVK G     R+ GVVTNW
Sbjct:   37 SKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGDYVVVKHAALFTSTVMARTLALPNVKLFNATAVEDLIVKEGKDGKQRIAGVVTNW 203          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 7.186e-50
Identity = 100/154 (64.94%), Postives = 119/154 (77.27%), Query Frame = 3
Query:  261 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK----GGRVGGVVTNW 707
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L K  P+++IAIIE SVSPGGGAWLGGQLFSAM++RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  PN+KLFNA   EDLI +    G R+ GVVTNW
Sbjct:   44 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQMPNIKLFNATCVEDLITRPSEEGVRIAGVVTNW 197          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.038e-48
Identity = 100/154 (64.94%), Postives = 117/154 (75.97%), Query Frame = 3
Query:  261 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK----GGRVGGVVTNW 707
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS  Y L K  P+++IAIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  PN KLFNA   EDLI +    G R+ GVVTNW
Sbjct:   48 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIVGAGSCGLSTRYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQLPNCKLFNATCVEDLITRPSKEGVRISGVVTNW 201          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.147e-47
Identity = 98/186 (52.69%), Postives = 128/186 (68.82%), Query Frame = 3
Query:  183 LQPIKSSRPNNLSISASA---SPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKG-------GRVGGVVTNW 707
            + P+KS + +N +++  A    P  +L   KF PIKE  V R M RRY  DM   A +D    GAGSAGLSCAY L +  P+++I I+E +V+PGGG WLGGQL SAMV RKPA  FLD++G+ Y+++ N+VV+KHAALFTST++SK+LA PNVK+FNA A EDLI+K         R+ G VTNW
Sbjct:   24 MDPLKSKQQSNATVNKPAFKPEPAVNLTPIKFAPIKEHQVQRAMVRRYFQDMEERAISDVIIVGAGSAGLSCAYALGTARPDLKITILESNVAPGGGCWLGGQLMSAMVCRKPADEFLDQVGVPYEDEGNFVVVKHAALFTSTVLSKVLAMPNVKMFNATACEDLIIKPCPINPGVQRIAGCVTNW 209          
BLAST of CN186121 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 189.889 bits (481), Expect = 1.147e-47
Identity = 98/157 (62.42%), Postives = 121/157 (77.07%), Query Frame = 3
Query:  261 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSK-NPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDE--QDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVK-----GGRVGGVVTNW 707
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L+K  P+++IAI+E SVSPGGGAWLGGQLFSAMV+R+PA +FL+ELG+ Y+E    NYVV+KHA+LFTST+MSK+L+ PNVKLFNA A EDLI +       ++ GVV NW
Sbjct:   48 FKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASLFTSTLMSKVLSFPNVKLFNATAVEDLITRPTENGNPQIAGVVVNW 204          
The following BLAST results are available for this feature:
BLAST of CN186121 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
THI4_CITSI4.005e-10998.03Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL7.606e-8480.95Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH8.703e-8075.12Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE2.453e-7469.86Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE2.712e-7368.60Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI2_SCHPO1.003e-5161.68Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]
THI4_FUSOX7.186e-5064.94Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_FUSSH1.038e-4864.94Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_UROFA1.147e-4752.69Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]
THI4_ASPOR1.147e-4762.42Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G10_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186121 ID=CN186121|Name=CN186121|organism=Citrus sinensis|type=EST|length=707bp
CGTTATCAAATCAAATTACTTCTCATTATCAAACTTCTAACCTTCAGGGG
AAGGAGGGGTAAAAAAAAAAAACCATGGCAGCCATGGCTTCTACAGCTTT
CGCTCCTTCAGTTTCGTCCACCACCAATAAGCTCTTTGACTCATCCTTTC
ATGGGGCTCCCATGTCACCTTCTCTTCTACGTCTTCAACCCATCAAATCT
TCTCGTCCCAACAACTTGTCCATTTCTGCTTCTGCTTCTCCTCCTTATGA
CTTGAACACTTTCAAGTTTGACCCCATCAAAGAATCCATTGTTTCTCGTG
AAATGACACGCAGGTACATGACGGACATGATCACTTATGCTGACACTGAT
GTGGTAGTGGTTGGTGCTGGCTCTGCTGGCCTCTCTTGTGCTTATGAGCT
CAGCAAAAACCCCAACATTCAGATTGCTATTATCGAACAGTCTGTTAGCC
CCGGCGGTGGCGCGTGGCTCGGTGGACAGCTCTTCTCTGCCATGGTTGTG
CGCAAACCAGCCCACATCTTCCTTGACGAGCTTGGCATCGACTACGATGA
GCAAGACAACTATGTTGTGATCAAGCATGCAGCGCTGTTCACCTCCACTA
TAATGAGCAAGCTCCTGGCCCGCCCCAACGTCAAGCTCTTTAATGCAGTG
GCAGCCGAGGACTTGATAGTCAAAGGCGGCAGAGTTGGTGGTGTGGTGAC
CAACTGG
back to top