DC900174

Overview
NameDC900174
Unique NameDC900174
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length450
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8201 contig Csv1_Contig8201:73..521. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYR5_ARATH (Uridine 5'-monophosphate synthase OS=Arabidopsis thaliana GN=PYRE-F PE=2 SV=2)

HSP 1 Score: 227.639 bits (579), Expect = 1.843e-59
Identity = 114/147 (77.55%), Postives = 123/147 (83.67%), Query Frame = 1
Query:    1 TGRKLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSKLRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVDXXXXXXXXXXXXXXXXAEMSSAGNLAKGDFRAA 441
            TG+KLF +M+KKE+NLCLAADV TAAELL IA+KVGPEICLLKTHVDILPDFTPDFGSKLRAIA+KH FLIFEDRKFADIGNTVTMQ EGGIF IL+WADIINAH+ISGPGIVD                AEMSSAGNLA GD+ AA
Sbjct:  230 TGKKLFDIMLKKETNLCLAADVGTAAELLDIADKVGPEICLLKTHVDILPDFTPDFGSKLRAIADKHKFLIFEDRKFADIGNTVTMQYEGGIFKILEWADIINAHVISGPGIVDGLKLKGMPRGRGLLLLAEMSSAGNLATGDYTAA 376          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYR5_TOBAC (Uridine 5'-monophosphate synthase (Fragment) OS=Nicotiana tabacum GN=PYR5-6 PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 7.003e-59
Identity = 113/147 (76.87%), Postives = 124/147 (84.35%), Query Frame = 1
Query:    1 TGRKLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSKLRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVDXXXXXXXXXXXXXXXXAEMSSAGNLAKGDFRAA 441
            TG+KLF++MV+KE+NLCL+ADVATAAELL IA+KVGPEIC+LKTHVDILPDFTPDFGSKLR+IA+KHNFLIFEDRKFADIGNTVTMQ EGGIF ILDWADI NAHIISGPGIVD                AEMSSAGNLA G + AA
Sbjct:  216 TGKKLFEIMVQKETNLCLSADVATAAELLDIADKVGPEICMLKTHVDILPDFTPDFGSKLRSIADKHNFLIFEDRKFADIGNTVTMQYEGGIFRILDWADITNAHIISGPGIVDGLKLKGLSRGRGLLLLAEMSSAGNLATGAYTAA 362          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYR5_PONAB (Uridine 5'-monophosphate synthase OS=Pongo abelii GN=UMPS PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 7.281e-40
Identity = 80/144 (55.56%), Postives = 101/144 (70.14%), Query Frame = 1
Query:   10 KLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSKLRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVDXXXXXXXXXXXXXXXXAEMSSAGNLAKGDFRAA 441
            KL ++M KKE+NLCL+ADV+ A ELLQ+A+ +GP IC+LKTHVDIL DFT D   +L  +A++H FLIFEDRKFADIGNTV  Q EGG+F I  WAD++NAH++ G G+V                 AEMSS G+LA GD+  A
Sbjct:  242 KLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRA 385          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYR5_MOUSE (Uridine 5'-monophosphate synthase OS=Mus musculus GN=Umps PE=2 SV=3)

HSP 1 Score: 161.384 bits (407), Expect = 1.622e-39
Identity = 81/144 (56.25%), Postives = 101/144 (70.14%), Query Frame = 1
Query:   10 KLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSKLRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVDXXXXXXXXXXXXXXXXAEMSSAGNLAKGDFRAA 441
            KL ++M KKE+NLCL+ADV+ A ELLQ+A+ +GP IC+LKTHVDIL DFT D   +L A+A++H FLIFEDRKFADIGNTV  Q E G F I  WADI+NAH++ G G+V                 AEMSSAG+LA G++  A
Sbjct:  242 KLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTALAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGLQEVGLPLHRACLLIAEMSSAGSLATGNYTKA 385          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYR5_HUMAN (Uridine 5'-monophosphate synthase OS=Homo sapiens GN=UMPS PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.118e-39
Identity = 81/144 (56.25%), Postives = 100/144 (69.44%), Query Frame = 1
Query:   10 KLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSKLRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVDXXXXXXXXXXXXXXXXAEMSSAGNLAKGDFRAA 441
            KL ++M KKE+NLCL+ADV+ A ELLQ+A+ +GP IC+LKTHVDIL DFT D   +L  +A+ H FLIFEDRKFADIGNTV  Q EGGIF I  WAD++NAH++ G G+V                 AEMSS G+LA GD+  A
Sbjct:  242 KLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRA 385          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYR5_BOVIN (Uridine 5'-monophosphate synthase OS=Bos taurus GN=UMPS PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.518e-37
Identity = 78/144 (54.17%), Postives = 97/144 (67.36%), Query Frame = 1
Query:   10 KLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSKLRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVDXXXXXXXXXXXXXXXXAEMSSAGNLAKGDFRAA 441
            KL ++M KKE+NLCL+ADV+ + ELLQ+A+ +G  ICLLK HVDIL DFT D   +L  +A++H FLIFEDRKFADIGNTV  Q EGG+F I  WAD++NAH + G G+V                 AEMSSAG LA G +  A
Sbjct:  242 KLLRLMQKKETNLCLSADVSESRELLQLADALGSRICLLKIHVDILNDFTLDVMKELTTLAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHAVPGSGVVKGLEEVGLPLHRACLLVAEMSSAGTLATGSYTEA 385          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYRF_PHYBL (Orotidine 5'-phosphate decarboxylase OS=Phycomyces blakesleeanus GN=pyrG PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.500e-34
Identity = 71/142 (50.00%), Postives = 93/142 (65.49%), Query Frame = 1
Query:    7 RKLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSKLRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVDXXXXXXXXXXXXXXXXAEMSSAGNLAKGDF 432
            R LF++M +K++NL +A DV T  ELL IA+ VGP +C+LKTH+DI+ DF  D  ++L A+A+KH+FLIFEDRKFADIGNTV  Q E G++ I  W+ I NAH + G GI+                 AEMSS G L KG +
Sbjct:   22 RSLFELMERKKTNLSVAVDVTTKKELLSIADSVGPYVCVLKTHIDIVEDFDKDLVAQLEALAKKHDFLIFEDRKFADIGNTVKHQYEKGVYKIASWSHITNAHTVPGEGIIKGLGEVGLPLGRGLLLLAEMSSKGALTKGSY 163          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYRF_ASHGO (Orotidine 5'-phosphate decarboxylase OS=Ashbya gossypii GN=URA3 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.330e-33
Identity = 73/148 (49.32%), Postives = 100/148 (67.57%), Query Frame = 1
Query:    7 RKLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSK-LRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIV---DXXXXXXXXXXXXXXXXAEMSSAGNLAKGDFRA 438
            RKL  +M +K++NLC + DV T+ +LL++A+ +GP ICLLKTHVDIL DF  +   K L+ +A KHNF+IFEDRKFADIGNTV +Q   G++ I +WADI NAH ++GPG++                    AE+SS G+LA+GD+ A
Sbjct:   19 RKLLALMHEKKTNLCASLDVRTSRKLLELADTLGPHICLLKTHVDILTDFDIETTVKPLQQLAAKHNFMIFEDRKFADIGNTVKLQYSSGVYRIAEWADITNAHGVTGPGVIAGLKEAAKLASQEPRGLLMLAELSSQGSLARGDYTA 166          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYRF_RHIRA (Orotidine 5'-phosphate decarboxylase OS=Rhizomucor racemosus GN=pyrG PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.870e-33
Identity = 71/142 (50.00%), Postives = 90/142 (63.38%), Query Frame = 1
Query:    7 RKLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSKLRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVDXXXXXXXXXXXXXXXXAEMSSAGNLAKGDF 432
            R LF++M + ESNL +A DV T  ELL IA+ VGP +C+LKTH+DI+ DF  D  ++L  +A+KH+FLIFEDRKFADIGNTV  Q   GI+ I  W+ I NAH + G GI+                 AEMSS G L KG +
Sbjct:   20 RSLFELMERNESNLSVAVDVTTKKELLSIADAVGPFVCVLKTHIDIVEDFDHDLVAQLEQLAKKHDFLIFEDRKFADIGNTVKHQYANGIYKIASWSHITNAHTVPGEGIIKGLGEVGLPLGRGLLLLAEMSSKGALTKGSY 161          
BLAST of DC900174 vs. ExPASy Swiss-Prot
Match: PYRF_YEAST (Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae GN=URA3 PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 1.126e-32
Identity = 72/145 (49.66%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   10 KLFQVMVKKESNLCLAADVATAAELLQIAEKVGPEICLLKTHVDILPDFTPDFGSK-LRAIAEKHNFLIFEDRKFADIGNTVTMQAEGGIFCILDWADIINAHIISGPGIVD---XXXXXXXXXXXXXXXXAEMSSAGNLAKGDF 432
            KLF +M +K++NLC + DV T  ELL++ E +GP+ICLLKTHVDIL DF+ +   K L+A++ K+NFL+FEDRKFADIGNTV +Q   G++ I +WADI NAH + GPGIV                    AE+S  G+LA G++
Sbjct:   20 KLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEY 164          
The following BLAST results are available for this feature:
BLAST of DC900174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
PYR5_ARATH1.843e-5977.55Uridine 5'-monophosphate synthase OS=Arabidopsis t... [more]
PYR5_TOBAC7.003e-5976.87Uridine 5'-monophosphate synthase (Fragment) OS=Ni... [more]
PYR5_PONAB7.281e-4055.56Uridine 5'-monophosphate synthase OS=Pongo abelii ... [more]
PYR5_MOUSE1.622e-3956.25Uridine 5'-monophosphate synthase OS=Mus musculus ... [more]
PYR5_HUMAN2.118e-3956.25Uridine 5'-monophosphate synthase OS=Homo sapiens ... [more]
PYR5_BOVIN1.518e-3754.17Uridine 5'-monophosphate synthase OS=Bos taurus GN... [more]
PYRF_PHYBL3.500e-3450.00Orotidine 5'-phosphate decarboxylase OS=Phycomyces... [more]
PYRF_ASHGO1.330e-3349.32Orotidine 5'-phosphate decarboxylase OS=Ashbya gos... [more]
PYRF_RHIRA3.870e-3350.00Orotidine 5'-phosphate decarboxylase OS=Rhizomucor... [more]
PYRF_YEAST1.126e-3249.66Orotidine 5'-phosphate decarboxylase OS=Saccharomy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900174 VSS Citrus sinensis cDNA clone VS28201 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900174 ID=DC900174|Name=DC900174|organism=Citrus sinensis|type=EST|length=450bp
ACTGGGAGAAAATTGTTTCAAGTGATGGTGAAGAAGGAGAGTAATTTGTG
TTTGGCTGCTGATGTTGCCACTGCTGCTGAGTTGCTTCAAATTGCCGAGA
AGGTTGGACCAGAGATCTGCTTGTTGAAAACCCATGTCGATATATTGCCT
GATTTCACCCCAGATTTTGGTTCCAAACTTCGTGCGATTGCAGAAAAGCA
TAACTTCCTAATTTTTGAAGATCGCAAGTTTGCGGACATTGGTAACACTG
TGACCATGCAGGCTGAAGGTGGTATATTTTGTATATTGGATTGGGCCGAT
ATAATAAATGCTCACATAATCTCTGGACCGGGAATTGTGGATGGTCTGAA
ATTAAAGGGATTGCCTCGTGGTAGGGGTCTGTTGCTGCTGGCTGAGATGA
GCTCAGCTGGTAACCTAGCAAAGGGAGACTTCAGAGCAGCTGGAAATGCG
back to top