CN186118

Overview
NameCN186118
Unique NameCN186118
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length786
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN186118_ssr578 microsatellite CN186118_ssr578:578..587. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2523 contig Csv1_Contig2523:1..786. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186118 vs. ExPASy Swiss-Prot
Match: SYP22_ARATH (Syntaxin-22 OS=Arabidopsis thaliana GN=SYP22 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 5.022e-34
Identity = 80/136 (58.82%), Postives = 96/136 (70.59%), Query Frame = -3
Query:  377 QRLAAERETAYTPFVPQAVLPSSYTAHELDISSDRSAEQHALLVESRRQEVVLLDXXXXXXXXXXXXXXXXXXXXXXXXXEVNEVFKDLAVLVHEQGTIIDDIGSHIENSQVATAQGKSQLVKAAKTQRSNSSLTC 784
            Q+ AAERET YTPFVPQ+ LPSSYTA E+D    +  EQ A L ES+RQE+VLLD                         EVNE+FKDLAVLV++QG +IDDIG+HI+NS+ AT+QGKSQLV+AAKTQ+SNSSLTC
Sbjct:  118 QQTAAERETTYTPFVPQSALPSSYTAGEVD----KVPEQRAQLQESKRQELVLLDNEIAFNEAVIEEREQGIQEIHQQIGEVNEIFKDLAVLVNDQGVMIDDIGTHIDNSRAATSQGKSQLVQAAKTQKSNSSLTC 249          
BLAST of CN186118 vs. ExPASy Swiss-Prot
Match: SYP23_ARATH (Syntaxin-23 OS=Arabidopsis thaliana GN=SYP23 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.353e-29
Identity = 68/123 (55.28%), Postives = 83/123 (67.48%), Query Frame = -3
Query:  416 QRLAAERETAYTPFVPQAVLPSSYTAHELDISSDRSAEQHALLVESRRQEVVLLDXXXXXXXXXXXXXXXXXXXXXXXXXEVNEVFKDLAVLVHEQGTIIDDIGSHIENSQVATAQGKSQLVK 784
            QRLAAERET Y P V +  LPSSYT+ E+D++ D+  EQ ALLVES+RQE+VLLD                         EV+E+FKDLAVLVH+QG +IDDIG+HI+NS  ATAQGKS LV+
Sbjct:  123 QRLAAERETVYAPLVHKPSLPSSYTSSEIDVNGDKHPEQRALLVESKRQELVLLDNEIAFNEAVIEEREQGIQEIQQQIGEVHEIFKDLAVLVHDQGNMIDDIGTHIDNSYAATAQGKSHLVR 245          
BLAST of CN186118 vs. ExPASy Swiss-Prot
Match: SYP21_ARATH (Syntaxin-21 OS=Arabidopsis thaliana GN=SYP21 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.669e-27
Identity = 70/136 (51.47%), Postives = 86/136 (63.24%), Query Frame = -3
Query:  377 QRLAAERETAYTPFVPQAVLPSSYTAHELDISSDRSAEQHALLVESRRQEVVLLDXXXXXXXXXXXXXXXXXXXXXXXXXEVNEVFKDLAVLVHEQGTIIDDIGSHIENSQVATAQGKSQLVKAAKTQRSNSSLTC 784
            QRLAAERE  YTP V + + P+SY A ELD  S R ++Q ALL++SRRQEVV LD                         +VN +FKDLA++V+ QG I+DDI S+++NS  AT Q   QL KAAKTQRSNSSLTC
Sbjct:  126 QRLAAEREITYTPVVTKEI-PTSYNAPELDTESLRISQQQALLLQSRRQEVVFLDNEITFNEAIIEEREQGIREIEDQIRDVNGMFKDLALMVNHQGNIVDDISSNLDNSHAATTQATVQLRKAAKTQRSNSSLTC 260          
BLAST of CN186118 vs. ExPASy Swiss-Prot
Match: SYP24_ARATH (Putative syntaxin-24 OS=Arabidopsis thaliana GN=SYP24 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 8.317e-21
Identity = 65/134 (48.51%), Postives = 79/134 (58.96%), Query Frame = -3
Query:  383 QRLAAERETAYTPFVPQAVLPSSYTAHELDISSDRSAEQHALLVESRRQEVVLLDXXXXXXXXXXXXXXXXXXXXXXXXXEVNEVFKDLAVLVHEQGTIIDDIGSHIENSQVATAQGKSQLVKAAKTQRSNSSL 784
            Q +  ERET+Y PF P+     S+++ E+DI  DRS EQ  L+ ESRRQE+VLLD                         EV E+FKDLAV+V  QGTI DDI   I+N + A AQGKS LVKA+ TQ SNSSL
Sbjct:  209 QHITVERETSYIPFDPKG----SFSSSEVDIGYDRSQEQRVLM-ESRRQEIVLLDNEISLNEARIEAREQGIQEVKHQISEVMEMFKDLAVMVDHQGTI-DDIDEKIDNLRSAAAQGKSHLVKASNTQGSNSSL 336          
The following BLAST results are available for this feature:
BLAST of CN186118 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SYP22_ARATH5.022e-3458.82Syntaxin-22 OS=Arabidopsis thaliana GN=SYP22 PE=1 ... [more]
SYP23_ARATH6.353e-2955.28Syntaxin-23 OS=Arabidopsis thaliana GN=SYP23 PE=2 ... [more]
SYP21_ARATH2.669e-2751.47Syntaxin-21 OS=Arabidopsis thaliana GN=SYP21 PE=1 ... [more]
SYP24_ARATH8.317e-2148.51Putative syntaxin-24 OS=Arabidopsis thaliana GN=SY... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G09_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186118 ID=CN186118; Name=CN186118; organism=Citrus sinensis; type=EST; length=786bp
TTTTTTTTTTTTTTTTTCGAACCATTTTTTAATTAATGATTAACAATAAA
AGAGACATTACATAATAAGCCGAAACACAAATTCCACAAACCCAAAGAAG
CACCAACTTAGAGTAACAAAAAGACACCCGCCACCCAAGCAACTCAGATG
TCCTAACTGGATGCAACCCTATTATGCAGTAACACTAAACGTCCGACACA
TGCTCCTCAGCAATGATTCTTCATGAAACATCAGCAAAGAGATCAGCAAG
AGATCACCCTCTCGTTGCAGGTGGTCTCAGATTTATCTCTATACTCCCAT
TGAGATAATATTGCGATCAAGCTGCAAGTACTACGACCAATATAAGAAGC
ACGATCCCAAATATCACCAAAAGCAGACAGGTCAAAGAAGAATTTGATCT
TTGGGTCTTGGCAGCTTTCACGAGTTGTGATTTTCCCTGTGCAGTTGCTA
CTTGGGAATTTTCAATATGAGATCCAATATCATCAATGATAGTTCCTTGC
TCATGGACTAATACAGCAAGATCTTTGAAAACCTCATTCACTTCACCAAT
TTGTTGTTGGATTTCTTGTATTCCGAGCTCTCTCTCTTCAATTATAGCCT
CATTGAAGGCAATCTCATTGTCCAATAGCACAACCTCCTGTCTTCTAGAT
TCCACAAGAAGCGCATGCTGTTCTGCACTCCTATCTGAACTTATATCTAG
TTCATGGGCTGTATAGCTGGAAGGAAGAACTGCCTGTGGAACAAAAGGAG
TGTATGCTGTTTCCCTTTCAGCAGCAAGCCTTTGAG
back to top