CN186116

Overview
NameCN186116
Unique NameCN186116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length822
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2522 contig Csv1_Contig2522:1..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186116 vs. ExPASy Swiss-Prot
Match: PAO_ARATH (Pheophorbide a oxygenase, chloroplastic OS=Arabidopsis thaliana GN=PAO PE=1 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.829e-106
Identity = 191/272 (70.22%), Postives = 208/272 (76.47%), Query Frame = 2
Query:   14 IFTSPRKTLPFFPLRTPKRQITVKSLP*RSKNL-SPLRVXXXXXXXXXXXEETVRKDEKEDYGSLVDDEYG--KESSDSKFSWRDHWYPVSLVEDLDPNLPTAFQLLGRDLVLWFDNNSNKWVAFDDKCPHRLAPLSEGRIDENGHLQCSYHGWSFDGCGSCTRIPQAASEGPEARAIQSPRACATRFPTMVSQGLLFVWPDEYGQERANATKPPMLPDAFDKPEFSSVTIQRDLFYGYDTLMENVSDPSHIDFAHHKVTGRRDRAKPLPFK 820
            I  S  K +PF    T K  + V   P RSK   +PLRV            E  R          +++EYG  KE   S+F WRDHWYPVSLVEDLDPN+PT FQLLGRDLVLWFD N  KW AFDD CPHRLAPLSEGR+DENGHLQCSYHGWSF GCGSCTRIPQAA+ GPEARA++SPRACA +FPTMVSQGLLFVWPDE G +RAN+ +PP LPD FDKPEFS+VTIQRDLFYGYDTLMENVSDPSHIDFAHHKVTGRRDRAKPLPFK
Sbjct:   13 ITKSQSKKIPFLS-PTTKFPLKVSISPSRSKLFHNPLRVAAPPSVPTSDSTEEKR----------IEEEYGGDKEEEGSEFKWRDHWYPVSLVEDLDPNVPTPFQLLGRDLVLWFDRNDQKWAAFDDLCPHRLAPLSEGRLDENGHLQCSYHGWSFGGCGSCTRIPQAATSGPEARAVKSPRACAIKFPTMVSQGLLFVWPDENGWDRANSIEPPRLPDDFDKPEFSTVTIQRDLFYGYDTLMENVSDPSHIDFAHHKVTGRRDRAKPLPFK 273          
BLAST of CN186116 vs. ExPASy Swiss-Prot
Match: CAO_DUNSA (Chlorophyllide a oxygenase, chloroplastic OS=Dunaliella salina GN=CAO PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.005e-20
Identity = 65/194 (33.51%), Postives = 86/194 (44.33%), Query Frame = 2
Query:  254 RDHWYPVSLVEDLDPNLPTAFQLLGRDLVLWFDNNSNKWVAFDDKCPHRLAPLSEGRIDENGHLQCSYHGWSFDGCGSCTRIPQAASEGPEARAIQSPRAC----ATRFPTMVSQGLLFVWPDEYGQERANATKPPMLPDAFDKPEFS---SVTIQRDLFYGYDTLMENVSDPSHIDFAHHKVTGRRDRAKPLP 814
            R+ WYP    + L+P +   F L G   VL+ D +S       D C HR  PLS G++  NGH+QC YHGW FDG G+CT++P             S R C        P +   G ++VWP +          PP LP  F  P         I  D+   +  LMEN+ D +H  F H   T    R  P+P
Sbjct:  131 RNFWYPTEFAKKLEPGMMVPFDLFGVPWVLFRDEHSAP-TCIKDSCAHRACPLSLGKVI-NGHVQCPYHGWEFDGSGACTKMP-------------STRMCHGVGVAALPCVEKDGFVWVWPGD--------GPPPDLPPDFTAPPAGYDVHAEIMVDVPVEHGLLMENLLDLAHAPFTH---TTTFARGWPIP 298          
BLAST of CN186116 vs. ExPASy Swiss-Prot
Match: CAO_CHLRE (Chlorophyllide a oxygenase, chloroplastic OS=Chlamydomonas reinhardtii GN=CAO PE=2 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 2.804e-14
Identity = 60/201 (29.85%), Postives = 85/201 (42.29%), Query Frame = 2
Query:  221 GKESS-DSKFSWRDHWYPVSLVEDLDPNLPTAFQLLGRDLVLWFDNNSNKWVAFDDKCPHRLAPLSEGRIDENGHLQCSYHGWSFDGCGSCTRIPQAASEGPEARAIQSPRACATRFPTMVSQGLLFVWPDEYGQERANATKPPMLPDAFDKPE--FSSVTIQRDLFYGYDTLMENVSDPSHIDFAHHKVTGRRDRAKPLP 814
            G ESS + +   R+ WYP      L  +    F+L G   V++ D          D+C HR  PLS G++ E G + C YHGW F+G G+CT++P      P  R +          P     G ++VWP        +      LPD    PE       I  D+   +  L+EN+ D +H  F H   T    R  P+P
Sbjct:  290 GLESSMEIEEGLRNFWYPAEFSARLPKDTLVPFELFGEPWVMFRDEKGQP-SCIRDECAHRGCPLSLGKVVE-GQVMCPYHGWEFNGDGACTKMPST----PFCRNVG-----VAALPCAEKDGFIWVWP-------GDGLPAETLPDFAQPPEGFLIHAEIMVDVPVEHGLLIENLLDLAHAPFTH---TSTFARGWPVP 469          
BLAST of CN186116 vs. ExPASy Swiss-Prot
Match: CAO_ORYSJ (Chlorophyllide a oxygenase, chloroplastic OS=Oryza sativa subsp. japonica GN=CAO PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.701e-11
Identity = 49/189 (25.93%), Postives = 78/189 (41.27%), Query Frame = 2
Query:  248 SWRDHWYPVSLVEDLDPNLPTAFQLLGRDLVLWFDNNSNKWVAFDDK----------CPHRLAPLSEGRIDENGHLQCSYHGWSFDGCGSCTRIPQAASEGPEARAIQSPRACATRFPTMVSQGLLFVWPDEYGQERANATKPPMLPDAFDKPEFSSVTIQRDLF----YGYDTLMENVSDPSHIDFAH 772
            S ++ WYPV+   DL             D ++  D    +WV F  K          C HR  PL  G ++E G +QC YHGW +   G C ++P         R++          P    +G++++WP   G +   +T P +LP        S  TI  ++       +  L++N+ D +H  F H
Sbjct:  215 SLKNFWYPVAFSSDLKD-----------DTMVPIDCFEEQWVIFRGKDGRPGCVMNTCAHRACPLHLGSVNE-GRIQCPYHGWEYSTDGKCEKMPSTKMLNVRIRSL----------PCFEQEGMVWIWP---GNDPPKSTIPSLLPP-------SGFTIHAEIVMELPVEHGLLLDNLLDLAHAPFTH 371          
The following BLAST results are available for this feature:
BLAST of CN186116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
PAO_ARATH1.829e-10670.22Pheophorbide a oxygenase, chloroplastic OS=Arabido... [more]
CAO_DUNSA2.005e-2033.51Chlorophyllide a oxygenase, chloroplastic OS=Dunal... [more]
CAO_CHLRE2.804e-1429.85Chlorophyllide a oxygenase, chloroplastic OS=Chlam... [more]
CAO_ORYSJ1.701e-1125.93Chlorophyllide a oxygenase, chloroplastic OS=Oryza... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G08_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186116 ID=CN186116|Name=CN186116|organism=Citrus sinensis|type=EST|length=822bp
TTTACTCTGCTAAATATTCACATCACCAAGAAAAACCCTTCCATTTTTTC
CCTTGAGAACCCCGAAGCGACAAATCACGGTAAAAAGCTTGCCATAAAGA
AGCAAGAATTTGTCTCCACTGCGAGTGGCAGCTCCTCCTTCAGACCCTGC
AGCATCAGATGAAGAAACGGTGAGAAAAGATGAGAAAGAAGATTATGGAT
CATTAGTCGATGATGAGTATGGTAAAGAGAGTTCGGATTCTAAGTTTTCT
TGGAGGGATCATTGGTACCCAGTTTCTTTAGTTGAAGATTTGGACCCGAA
CTTGCCAACAGCGTTTCAGCTTCTTGGGAGAGACTTAGTTCTTTGGTTTG
ATAACAATTCTAATAAATGGGTTGCATTTGATGACAAATGCCCTCATAGA
CTCGCCCCATTATCGGAAGGGCGGATCGATGAAAATGGGCATTTGCAGTG
TTCATACCATGGATGGTCTTTTGACGGGTGTGGATCTTGCACTCGCATTC
CCCAAGCAGCATCTGAAGGTCCTGAAGCTCGTGCAATTCAGTCTCCCAGA
GCGTGTGCTACGAGGTTTCCTACAATGGTGTCTCAAGGTCTGCTATTCGT
TTGGCCAGATGAGTATGGTCAGGAAAGAGCCAATGCCACCAAGCCACCAA
TGTTGCCTGATGCCTTTGACAAACCTGAGTTCTCATCGGTCACAATTCAG
CGGGATCTATTTTATGGCTATGACACTCTCATGGAAAATGTCTCAGATCC
TTCCCACATTGATTTTGCACATCACAAGGTTACTGGCAGAAGGGACAGGG
CCAAGCCTTTACCATTTAAGTT
back to top