DC900172

Overview
NameDC900172
Unique NameDC900172
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3018 contig Csv1_Contig3018:74..822. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_PETHY (Alcohol dehydrogenase 1 OS=Petunia hybrida GN=ADH1 PE=3 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 5.274e-70
Identity = 127/149 (85.23%), Postives = 139/149 (93.29%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDY-DXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            + N+AKK GVTEFVNPKD+ D PVQQVIA+MT+GGVDRSVECTG+V AMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKP+SD+PSVV+KYM KELE+EKFITH VPFSEINKAFD ML GESIRC+I M+
Sbjct:  233 RFNDAKKFGVTEFVNPKDHGDKPVQQVIAEMTDGGVDRSVECTGNVNAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPKSDIPSVVDKYMKKELELEKFITHQVPFSEINKAFDYMLKGESIRCMITME 381          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_ARATH (Alcohol dehydrogenase class-P OS=Arabidopsis thaliana GN=ADH1 PE=1 SV=2)

HSP 1 Score: 264.233 bits (674), Expect = 5.274e-70
Identity = 124/149 (83.22%), Postives = 139/149 (93.29%), Query Frame = 1
Query:   10 TQQINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            +++ ++AK+ GVTE VNPKD+D P+QQVIA+MT+GGVDRSVECTGSVQAMI AFECVHDGWGVAVLVGVP+KDDAFKTHPMN LNERTLKGTFFGNYKP++D+P VVEKYMNKELE+EKFITHTVPFSEINKAFD ML GESIRCII M
Sbjct:  229 SKRFDQAKEFGVTECVNPKDHDKPIQQVIAEMTDGGVDRSVECTGSVQAMIQAFECVHDGWGVAVLVGVPSKDDAFKTHPMNFLNERTLKGTFFGNYKPKTDIPGVVEKYMNKELELEKFITHTVPFSEINKAFDYMLKGESIRCIITM 377          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_PEA (Alcohol dehydrogenase 1 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 8.997e-70
Identity = 124/144 (86.11%), Postives = 136/144 (94.44%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            AKK GV EFVNPK++D PVQQVIA+MTNGGVDR+VECTGS+QAMISAFECVHDGWGVAVLVGVP+KDDAFKTHPMN LNERTLKGTF+GNYKPR+DLP+VVEKYM  ELE+EKFITHTVPFSEINKAFD ML GESIRCII+M+
Sbjct:  236 AKKFGVNEFVNPKEHDKPVQQVIAEMTNGGVDRAVECTGSIQAMISAFECVHDGWGVAVLVGVPSKDDAFKTHPMNFLNERTLKGTFYGNYKPRTDLPNVVEKYMKGELELEKFITHTVPFSEINKAFDYMLKGESIRCIIKME 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_SOLTU (Alcohol dehydrogenase 1 OS=Solanum tuberosum GN=ADH1 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.465e-69
Identity = 122/148 (82.43%), Postives = 136/148 (91.89%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  +AKK GVTEFVNPKDY  PVQ+VIA+MT+GGVDRSVECTG + AMISAFECVHDGWGVAVLVGVP+K+  FKTHPMNLLNERTLKGTFFGNYKPRSD+PSVVEKYMNKELE+EKFITHT+PF+EINKAFDLML GE +RCII M+
Sbjct:  232 RFEQAKKFGVTEFVNPKDYSKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGWGVAVLVGVPHKEAVFKTHPMNLLNERTLKGTFFGNYKPRSDIPSVVEKYMNKELELEKFITHTLPFAEINKAFDLMLKGEGLRCIITME 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_TRIRP (Alcohol dehydrogenase 1 OS=Trifolium repens GN=ADH1 PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 7.616e-69
Identity = 122/144 (84.72%), Postives = 135/144 (93.75%), Query Frame = 1
Query:   28 AKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            AKK GV EFVNPKD+D PVQQVIA+MT+GGVDR+VECTGS+QAMISAFECVHDGWGVAVLVGVP KDDAFKTHPMN LNERTLKGTF+GNYKPR+DLP+VVE+YM  ELE+EKFITH++PFSEINKAFD ML GESIRCIIRM+
Sbjct:  236 AKKFGVNEFVNPKDHDKPVQQVIAEMTDGGVDRAVECTGSIQAMISAFECVHDGWGVAVLVGVPKKDDAFKTHPMNFLNERTLKGTFYGNYKPRTDLPNVVEQYMKGELELEKFITHSIPFSEINKAFDYMLKGESIRCIIRME 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH3_SOLTU (Alcohol dehydrogenase 3 OS=Solanum tuberosum GN=ADH3 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.299e-68
Identity = 121/148 (81.76%), Postives = 135/148 (91.22%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  +AKK GVTEFVNPKDY  PVQ+VIA+MT+GGVDRSVECTG + AMISAFECVHDGWGVAVLVGVP+K+  FKTHPMN LNERTLKGTFFGNYKPRSD+PSVVEKYMNKELE+EKFITHT+PF+EINKAFDLML GE +RCII M+
Sbjct:  232 RFEQAKKFGVTEFVNPKDYSKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGWGVAVLVGVPHKEAVFKTHPMNFLNERTLKGTFFGNYKPRSDIPSVVEKYMNKELELEKFITHTLPFAEINKAFDLMLKGEGLRCIITME 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH2_SOLTU (Alcohol dehydrogenase 2 OS=Solanum tuberosum GN=ADH2 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.299e-68
Identity = 121/148 (81.76%), Postives = 135/148 (91.22%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  +AKK GVTEFVNPKDY  PVQ+VIA+MT+GGVDRSVECTG + AMISAFECVHDGWGVAVLVGVP+K+  FKTHPMN LNERTLKGTFFGNYKPRSD+PSVVEKYMNKELE+EKFITHT+PF+EINKAFDLML GE +RCII M+
Sbjct:  232 RFEQAKKFGVTEFVNPKDYSKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGWGVAVLVGVPHKEAVFKTHPMNFLNERTLKGTFFGNYKPRSDIPSVVEKYMNKELELEKFITHTLPFAEINKAFDLMLKGEGLRCIITME 379          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH2_SOLLC (Alcohol dehydrogenase 2 OS=Solanum lycopersicum GN=ADH2 PE=2 SV=2)

HSP 1 Score: 255.758 bits (652), Expect = 1.876e-67
Identity = 119/147 (80.95%), Postives = 133/147 (90.48%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRM 456
            +  +AKK GVTEFVNPKDY  PVQ+VIA+MT+GGVDRSVECTG + AMISAFECVHDGWGVAVLVGVP+K+  FKTHP+N LNERTLKGTFFGNYKPRSD+P VVEKYMNKELE+EKFITHT+PF+EINKAFDLML GE +RCII M
Sbjct:  232 RFEQAKKFGVTEFVNPKDYSKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGWGVAVLVGVPHKEAVFKTHPLNFLNERTLKGTFFGNYKPRSDIPCVVEKYMNKELELEKFITHTLPFAEINKAFDLMLKGEGLRCIITM 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_PENAM (Alcohol dehydrogenase 1 OS=Pennisetum americanum GN=ADH1 PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.450e-67
Identity = 120/148 (81.08%), Postives = 133/148 (89.86%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  EAKK G TEFVNPKD++ PVQ+V+ADMTNGGVDRSVECTG++ AMI AFECVHDGWGVAVLVGVP+KD  FKTHPMN LNERTLKGTFFGN+KPR+DLP+VVE YM KELEVEKFITH+VPFSEINKAFDLM  GE IRCIIRM+
Sbjct:  231 RFEEAKKFGCTEFVNPKDHNKPVQEVLADMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNFKPRTDLPNVVELYMKKELEVEKFITHSVPFSEINKAFDLMAKGEGIRCIIRME 378          
BLAST of DC900172 vs. ExPASy Swiss-Prot
Match: ADH1_HORVU (Alcohol dehydrogenase 1 OS=Hordeum vulgare GN=ADH1 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 4.179e-67
Identity = 121/148 (81.76%), Postives = 131/148 (88.51%), Query Frame = 1
Query:   16 QINEAKKXGVTEFVNPKDYDXPVQQVIADMTNGGVDRSVECTGSVQAMISAFECVHDGWGVAVLVGVPNKDDAFKTHPMNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELEVEKFITHTVPFSEINKAFDLMLAGESIRCIIRMD 459
            +  EA+K G TEFVNPKD+  PVQQV+ADMTNGGVDRSVECTG+V AMI AFECVHDGWGVAVLVGVP+KD  FKTHPMN LNERTLKGTFFGN+KPR+DLP+VVE YM KELEVEKFITH+VPFSEIN AFDLM  GE IRCIIRMD
Sbjct:  231 RFEEARKFGCTEFVNPKDHTKPVQQVLADMTNGGVDRSVECTGNVNAMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNFKPRTDLPNVVEMYMKKELEVEKFITHSVPFSEINTAFDLMAKGEGIRCIIRMD 378          
The following BLAST results are available for this feature:
BLAST of DC900172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
ADH1_PETHY5.274e-7085.23Alcohol dehydrogenase 1 OS=Petunia hybrida GN=ADH1... [more]
ADH1_ARATH5.274e-7083.22Alcohol dehydrogenase class-P OS=Arabidopsis thali... [more]
ADH1_PEA8.997e-7086.11Alcohol dehydrogenase 1 OS=Pisum sativum PE=3 SV=1[more]
ADH1_SOLTU4.465e-6982.43Alcohol dehydrogenase 1 OS=Solanum tuberosum GN=AD... [more]
ADH1_TRIRP7.616e-6984.72Alcohol dehydrogenase 1 OS=Trifolium repens GN=ADH... [more]
ADH3_SOLTU1.299e-6881.76Alcohol dehydrogenase 3 OS=Solanum tuberosum GN=AD... [more]
ADH2_SOLTU1.299e-6881.76Alcohol dehydrogenase 2 OS=Solanum tuberosum GN=AD... [more]
ADH2_SOLLC1.876e-6780.95Alcohol dehydrogenase 2 OS=Solanum lycopersicum GN... [more]
ADH1_PENAM2.450e-6781.08Alcohol dehydrogenase 1 OS=Pennisetum americanum G... [more]
ADH1_HORVU4.179e-6781.76Alcohol dehydrogenase 1 OS=Hordeum vulgare GN=ADH1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900172 VSS Citrus sinensis cDNA clone VS27V94 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900172 ID=DC900172|Name=DC900172|organism=Citrus sinensis|type=EST|length=749bp
TTTGATTGAACCCAGCAGATCAATGAAGCCAAGAAGTTNGGGGTTACCGA
GTTTGTGAATCCAAAAGATTATGACAANCCTGTTCAACAGGTGATTGCTG
ACATGACCAATGGTGGAGTGGATAGAAGTGTTGAATGTACTGGAAGCGTC
CAGGCCATGATTTCAGCATTTGAATGCGTTCACGATGGTTGGGGTGTTGC
TGTGCTTGTGGGTGTGCCAAACAAAGATGATGCATTCAAGACTCATCCCA
TGAATCTGCTTAATGAGAGGACTCTTAAGGGTACCTTCTTTGGCAACTAC
AAACCTCGCTCTGATCTTCCTTCTGTTGTTGAAAAATACATGAACAAGGA
GTTGGAGGTCGAGAAATTCATCACTCACACTGTGCCCTTCTCGGAGATAA
ACAAGGCATTTGACCTCATGCTTGCGGGAGAAAGCATTAGGTGCATCATT
CGCATGGATGGTTAGATGTGTCTGCTGTTGCTGATCAATCTAATGGAGGC
AGAATGAAGATGATCACATAATTTTCCAAGTTATATATTACCCCGAGAAT
AAGTAATTTATGCTGTATGTTTGATGACTTGCTGCGAATGGCTTTCAAAG
AGTTGTGTTTTCTACATATTTCTTACAGTCCCTTTTTTTGTTTTGTTTTT
CTGTTTGATGACTTGCTGCATATGGCGTACAAAGAGGTGTGTTTTCTACC
TATTTCTTACAGTACTTCTTTTTGTAGCTTATGTAATAAAGATTTTCGT
back to top