DC900171

Overview
NameDC900171
Unique NameDC900171
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length656
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5386 contig Csv1_Contig5386:85..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH_MALDO (Alcohol dehydrogenase OS=Malus domestica GN=ADH PE=2 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.795e-105
Identity = 181/217 (83.41%), Postives = 196/217 (90.32%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            TAGQVIRC+AAVAWEAGKPLVIEEVEVAPPQ NEVR+KILFTSLCHTDVYFWEAKGQ PLFPRI+GHEAGGIVESVGEGVTDL+ GDHVLPVFTGECK+C HC SEESNMCDLLRINTDRGVM++DG+SRFSIKGKPIYHFVGTSTFSEYTV HVGC+AKINP+APLDKVC+LSCGISTG GAT+NVAKPKKG +VA+F             R+SGA
Sbjct:    4 TAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKGQNPLFPRIYGHEAGGIVESVGEGVTDLKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFVGTSTFSEYTVVHVGCLAKINPSAPLDKVCLLSCGISTGLGATLNVAKPKKGSTVAVFGLGAVGLAAAEGARLSGA 220          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH1_ARATH (Alcohol dehydrogenase class-P OS=Arabidopsis thaliana GN=ADH1 PE=1 SV=2)

HSP 1 Score: 379.022 bits (972), Expect = 1.163e-104
Identity = 180/217 (82.95%), Postives = 194/217 (89.40%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            T GQ+IRCKAAVAWEAGKPLVIEEVEVAPPQK+EVR+KILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLP+FTGEC EC HCHSEESNMCDLLRINT+RG MI+DG+SRFSI GKPIYHF+GTSTFSEYTV H G VAKINP APLDKVC++SCG+STG GAT+NVAKPKKGQSVAIF             R++GA
Sbjct:    3 TTGQIIRCKAAVAWEAGKPLVIEEVEVAPPQKHEVRIKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPIFTGECGECRHCHSEESNMCDLLRINTERGGMIHDGESRFSINGKPIYHFLGTSTFSEYTVVHSGQVAKINPDAPLDKVCIVSCGLSTGLGATLNVAKPKKGQSVAIFGLGAVGLGAAEGARIAGA 219          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH1_ORYSJ (Alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=ADH1 PE=2 SV=2)

HSP 1 Score: 377.481 bits (968), Expect = 3.385e-104
Identity = 182/217 (83.87%), Postives = 191/217 (88.02%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            TAG+VI+CKAAVAWEA KPLVIEEVEVAPPQ  EVR+KILFTSLCHTDVYFWEAKGQTP+FPRIFGHEAGGIVESVGEGVTDL PGDHVLPVFTGECKEC HC S ESNMCDLLRINTDRGVMI DG+SRFSI GKPIYHFVGTSTFSEYTV HVGCVAKINPAAPLDKVCVLSCGISTG GAT+NVAKP KG +VAIF             R++GA
Sbjct:    3 TAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTPVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRINTDRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCVAKINPAAPLDKVCVLSCGISTGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGA 219          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH1_ORYSI (Alcohol dehydrogenase 1 OS=Oryza sativa subsp. indica GN=ADH1 PE=2 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 3.385e-104
Identity = 182/217 (83.87%), Postives = 191/217 (88.02%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            TAG+VI+CKAAVAWEA KPLVIEEVEVAPPQ  EVR+KILFTSLCHTDVYFWEAKGQTP+FPRIFGHEAGGIVESVGEGVTDL PGDHVLPVFTGECKEC HC S ESNMCDLLRINTDRGVMI DG+SRFSI GKPIYHFVGTSTFSEYTV HVGCVAKINPAAPLDKVCVLSCGISTG GAT+NVAKP KG +VAIF             R++GA
Sbjct:    3 TAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTPVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRINTDRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCVAKINPAAPLDKVCVLSCGISTGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGA 219          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH1_PETHY (Alcohol dehydrogenase 1 OS=Petunia hybrida GN=ADH1 PE=3 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 7.540e-104
Identity = 182/217 (83.87%), Postives = 192/217 (88.48%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQK EVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDL+PGDHVLPVFTGEC++C HC SEESNMCDLLRINTDRGVMI+DGQ+RFS  GKPIYHFVGTSTFSEYTV H GCV KI+P APLDKVCVLSCGISTG GAT+NVAKP KG +VAIF             R++GA
Sbjct:    5 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKMEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLKPGDHVLPVFTGECQQCRHCKSEESNMCDLLRINTDRGVMIHDGQTRFSKDGKPIYHFVGTSTFSEYTVCHSGCVTKIDPQAPLDKVCVLSCGISTGLGATLNVAKPTKGSTVAIFGLGAVGLAAAEGARIAGA 221          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH1_TRIRP (Alcohol dehydrogenase 1 OS=Trifolium repens GN=ADH1 PE=2 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.194e-103
Identity = 180/217 (82.95%), Postives = 190/217 (87.56%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            TAGQVI+C+AAVAWEAGKPLVIEEVEVAPPQ  EVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVT L+PGDH LPVFTGEC ECPHC SEESNMC+LLRINTDRGVMIND +SRFSIKG+P++HFVGTSTFSEYTV H GCVAKINP APLDKVC+LSCGI TG GATVNVAKPK G SVAIF             R+SGA
Sbjct:    4 TAGQVIKCRAAVAWEAGKPLVIEEVEVAPPQAGEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTHLKPGDHALPVFTGECGECPHCKSEESNMCNLLRINTDRGVMINDNKSRFSIKGQPVHHFVGTSTFSEYTVVHAGCVAKINPDAPLDKVCILSCGICTGLGATVNVAKPKPGSSVAIFGLGAVGLAAAEGARMSGA 220          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH3_SOLTU (Alcohol dehydrogenase 3 OS=Solanum tuberosum GN=ADH3 PE=2 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 2.865e-103
Identity = 180/217 (82.95%), Postives = 189/217 (87.10%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            T GQVIRCKAAVAWEAGKPLV+EEV+VAPPQK EVRLKIL+TSLCHTDVYFWEAKGQ P+FPRI GHEA GIVESVGEGVT+L PGDHVLPVFTGECK+C HC SEESNMC LLRINTDRGVMINDGQSRFSI GKPIYHFVGTSTFSEYTV HVGCVAKINP APLDKVCVLSCGISTG GAT+NVAKP KG SVAIF             R++GA
Sbjct:    4 TVGQVIRCKAAVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDVYFWEAKGQNPVFPRILGHEAAGIVESVGEGVTELAPGDHVLPVFTGECKDCAHCKSEESNMCSLLRINTDRGVMINDGQSRFSINGKPIYHFVGTSTFSEYTVVHVGCVAKINPLAPLDKVCVLSCGISTGLGATLNVAKPTKGSSVAIFGLGAVGLAAAEGARIAGA 220          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH2_SOLTU (Alcohol dehydrogenase 2 OS=Solanum tuberosum GN=ADH2 PE=2 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 2.865e-103
Identity = 180/217 (82.95%), Postives = 189/217 (87.10%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            T GQVIRCKAAVAWEAGKPLV+EEV+VAPPQK EVRLKIL+TSLCHTDVYFWEAKGQ P+FPRI GHEA GIVESVGEGVT+L PGDHVLPVFTGECK+C HC SEESNMC LLRINTDRGVMINDGQSRFSI GKPIYHFVGTSTFSEYTV HVGCVAKINP APLDKVCVLSCGISTG GAT+NVAKP KG SVAIF             R++GA
Sbjct:    4 TTGQVIRCKAAVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDVYFWEAKGQNPVFPRILGHEAAGIVESVGEGVTELAPGDHVLPVFTGECKDCAHCKSEESNMCSLLRINTDRGVMINDGQSRFSINGKPIYHFVGTSTFSEYTVVHVGCVAKINPLAPLDKVCVLSCGISTGLGATLNVAKPTKGSSVAIFGLGAVGLAAAEGARIAGA 220          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH1_PEA (Alcohol dehydrogenase 1 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 2.865e-103
Identity = 177/217 (81.57%), Postives = 189/217 (87.10%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            T GQ+I+C+AAVAWEAGKPLVIEEVEVAPPQ  EVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVT L+PGDH LPVFTGEC ECPHC SEESNMCDLLRINTDRGVM+ND +SRFSIKG+P++HFVGTSTFSEYTV H GCVAKINP APLDKVC+LSCGI TG GAT+NVAKPK G SVAIF             R+SGA
Sbjct:    4 TVGQIIKCRAAVAWEAGKPLVIEEVEVAPPQAGEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTHLKPGDHALPVFTGECGECPHCKSEESNMCDLLRINTDRGVMLNDNKSRFSIKGQPVHHFVGTSTFSEYTVVHAGCVAKINPDAPLDKVCILSCGICTGLGATINVAKPKPGSSVAIFGLGAVGLAAAEGARISGA 220          
BLAST of DC900171 vs. ExPASy Swiss-Prot
Match: ADH1_SOLTU (Alcohol dehydrogenase 1 OS=Solanum tuberosum GN=ADH1 PE=2 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 3.742e-103
Identity = 180/217 (82.95%), Postives = 189/217 (87.10%), Query Frame = 3
Query:    6 TAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQKNEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECPHCHSEESNMCDLLRINTDRGVMINDGQSRFSIKGKPIYHFVGTSTFSEYTVTHVGCVAKINPAAPLDKVCVLSCGISTGFGATVNVAKPKKGQSVAIFXXXXXXXXXXXXXRVSGA 656
            T GQVIRCKAAVAWEAGKPLV+EEV+VAPPQK EVRLKIL+TSLCHTDVYFWEAKGQ P+FPRI GHEA GIVESVGEGVT+L PGDHVLPVFTGECK+C HC SEESNMC LLRINTDRGVMINDGQSRFSI GKPIYHFVGTSTFSEYTV HVGCVAKINP APLDKVCVLSCGISTG GAT+NVAKP KG SVAIF             R++GA
Sbjct:    4 TVGQVIRCKAAVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDVYFWEAKGQNPVFPRILGHEAAGIVESVGEGVTELGPGDHVLPVFTGECKDCAHCKSEESNMCSLLRINTDRGVMINDGQSRFSINGKPIYHFVGTSTFSEYTVVHVGCVAKINPLAPLDKVCVLSCGISTGLGATLNVAKPTKGSSVAIFGLGAVGLAAAEGARIAGA 220          
The following BLAST results are available for this feature:
BLAST of DC900171 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 139
Match NameE-valueIdentityDescription
ADH_MALDO1.795e-10583.41Alcohol dehydrogenase OS=Malus domestica GN=ADH PE... [more]
ADH1_ARATH1.163e-10482.95Alcohol dehydrogenase class-P OS=Arabidopsis thali... [more]
ADH1_ORYSJ3.385e-10483.87Alcohol dehydrogenase 1 OS=Oryza sativa subsp. jap... [more]
ADH1_ORYSI3.385e-10483.87Alcohol dehydrogenase 1 OS=Oryza sativa subsp. ind... [more]
ADH1_PETHY7.540e-10483.87Alcohol dehydrogenase 1 OS=Petunia hybrida GN=ADH1... [more]
ADH1_TRIRP2.194e-10382.95Alcohol dehydrogenase 1 OS=Trifolium repens GN=ADH... [more]
ADH3_SOLTU2.865e-10382.95Alcohol dehydrogenase 3 OS=Solanum tuberosum GN=AD... [more]
ADH2_SOLTU2.865e-10382.95Alcohol dehydrogenase 2 OS=Solanum tuberosum GN=AD... [more]
ADH1_PEA2.865e-10381.57Alcohol dehydrogenase 1 OS=Pisum sativum PE=3 SV=1[more]
ADH1_SOLTU3.742e-10382.95Alcohol dehydrogenase 1 OS=Solanum tuberosum GN=AD... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900171 VSS Citrus sinensis cDNA clone VS27V94 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900171 ID=DC900171|Name=DC900171|organism=Citrus sinensis|type=EST|length=656bp
CTGGCACAGCTGGTCAAGTTATTCGCTGCAAAGCGGCGGTGGCATGGGAG
GCGGGGAAGCCACTGGTGATTGAAGAAGTGGAGGTGGCTCCACCACAGAA
AAATGAAGTTCGATTGAAGATCCTCTTCACCTCTTTATGCCATACTGATG
TTTACTTCTGGGAAGCCAAGGGACAAACACCTCTCTTTCCTCGCATTTTT
GGTCACGAAGCTGGAGGGATTGTAGAAAGTGTAGGGGAGGGGGTAACTGA
TCTCCAACCAGGAGACCATGTTCTTCCTGTGTTCACAGGAGAGTGCAAGG
AATGTCCTCACTGTCATTCAGAGGAAAGCAATATGTGTGACCTCCTCAGG
ATCAATACTGACAGGGGTGTTATGATTAATGATGGTCAGTCGAGATTCTC
GATTAAGGGGAAGCCAATTTACCATTTTGTGGGCACTTCTACCTTCAGTG
AATACACTGTTACCCATGTCGGTTGTGTTGCTAAGATCAATCCTGCTGCC
CCTCTTGACAAAGTTTGTGTGCTTAGCTGTGGAATCTCCACAGGTTTTGG
GGCTACTGTTAATGTCGCCAAACCGAAGAAGGGCCAGTCTGTTGCCATTT
TTGGATTGGGTGCAGNTGGCCTCGCTGCTGCCGAAGGGGCAAGGGTATCA
GGGGCT
back to top