DC900169

Overview
NameDC900169
Unique NameDC900169
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1213
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12448 contig Csv1_Contig12448:2121..3333. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: PSMD1_DICDI (26S proteasome non-ATPase regulatory subunit 1 OS=Dictyostelium discoideum GN=psmD1 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 5.644e-26
Identity = 76/229 (33.19%), Postives = 109/229 (47.60%), Query Frame = 3
Query:    6 FSQFWYWYPLIYFISLAFSPTALIGLNYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVDXXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVKSAPS-GFVLLRDLRPNEPEVLSLTDXXXXXXXXXXXXXXXXXXXXXXXMAVD------EEPQPPAPFEYT 671
            F QFWYW+P+ +F+ LA +PT++IGLN +L++P F F S+ +PSLF YP  T   TT+S  K+  A+LS S                        +     K K + EK+      +            FE   NPAR+VP Q ++++F +D+RY P+K +P+ G V+LRDL PNEPE L + +                        A         EP  P PFE+T
Sbjct:  755 FLQFWYWFPMTHFMGLALTPTSIIGLNKNLEMPVFTFKSNCRPSLFAYPPETKPSTTSSTNKIETAILSYSRKNKLQSSRSAMNIDQDVEKKEKEE--KEAKEKEAKEKE------EKEAAKAEEKEPLFERKSNPARIVPRQLQYVQF-DDARYQPIKKSPAIGIVMLRDLTPNEPEQLVVKEKPETKQETVGNQSGTATATASLPNATTTTSPTLPEPSTPEPFEFT 974          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: PSMD1_CHICK (26S proteasome non-ATPase regulatory subunit 1 OS=Gallus gallus GN=PSMD1 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 8.150e-25
Identity = 72/228 (31.58%), Postives = 105/228 (46.05%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGLNYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVD-----XXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVKS-APSGFVLLRDLRPNEPEVLSLTDXXXXXXXXXXXXXXXXXXXXXXXMAVDEEPQPPAPFEY 668
            VF+QFW+W+PL +F+SLAF+PT +IGLN DLK+P+ ++ S+ KPS F YP P  VP      K+  AVLS +                              K K   +K+ + M+VD                +F++L NPARV+PAQ K +   E  RY P K  +  G ++L+D   +  E++                              ++EP+PP PFEY
Sbjct:  765 VFTQFWFWFPLSHFLSLAFTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPPPLEVPKEKEKEKVSTAVLSIT-----------------------AKAKKKEKEKEKEKKEEEKMEVDETEKKDEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMTESCRYQPFKPLSIGGIIILKDTSEDMEELVE-----------------PVAAHGPKIEEEEQEPEPPEPFEY 952          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: PSMD1_RAT (26S proteasome non-ATPase regulatory subunit 1 OS=Rattus norvegicus GN=Psmd1 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.816e-24
Identity = 71/228 (31.14%), Postives = 106/228 (46.49%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGLNYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVD-----XXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVKS-APSGFVLLRDLRPNEPEVLSLTDXXXXXXXXXXXXXXXXXXXXXXXMAVDEEPQPPAPFEY 668
            VF+QFW+W+PL +F+SLA++PT +IGLN DLK+P+ ++ S+ KPS F YP P  VP      K+  AVLS +                           +  K K   +K+ + M+VD                +F++L NPARV+PAQ K +   E  RY P K  +  G ++L+D   +  E++                              ++EP+PP PFEY
Sbjct:  765 VFTQFWFWFPLSHFLSLAYTPTCIIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSIT-------------------------AKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLSMTETCRYQPFKPLSIGGIIILKDTSEDIEELVE-----------------PVAAHGPKIEEEEQEPEPPEPFEY 950          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: PSMD1_MOUSE (26S proteasome non-ATPase regulatory subunit 1 OS=Mus musculus GN=Psmd1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.816e-24
Identity = 71/228 (31.14%), Postives = 106/228 (46.49%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGLNYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVD-----XXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVKS-APSGFVLLRDLRPNEPEVLSLTDXXXXXXXXXXXXXXXXXXXXXXXMAVDEEPQPPAPFEY 668
            VF+QFW+W+PL +F+SLA++PT +IGLN DLK+P+ ++ S+ KPS F YP P  VP      K+  AVLS +                           +  K K   +K+ + M+VD                +F++L NPARV+PAQ K +   E  RY P K  +  G ++L+D   +  E++                              ++EP+PP PFEY
Sbjct:  765 VFTQFWFWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSIT-------------------------AKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLSMTETCRYQPFKPLSIGGIIILKDTSEDVEELVE-----------------PVAAHGPKIEEEEQEPEPPEPFEY 950          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: PSMD1_PONAB (26S proteasome non-ATPase regulatory subunit 1 OS=Pongo abelii GN=PSMD1 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 5.282e-24
Identity = 71/228 (31.14%), Postives = 106/228 (46.49%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGLNYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVD-----XXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVKS-APSGFVLLRDLRPNEPEVLSLTDXXXXXXXXXXXXXXXXXXXXXXXMAVDEEPQPPAPFEY 668
            VF+QFW+W+PL +F+SLA++PT +IGLN DLK+P+ ++ S+ KPS F YP P  VP      K+  AVLS +                           +  K K   +K+ + M+VD                +F++L NPARV+PAQ K +   E  RY P K  +  G ++L+D   +  E++                              ++EP+PP PFEY
Sbjct:  765 VFTQFWFWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSIT-------------------------AKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELVE-----------------PVAAHGPKIEEEEQEPEPPEPFEY 950          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: PSMD1_HUMAN (26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens GN=PSMD1 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 5.282e-24
Identity = 71/228 (31.14%), Postives = 106/228 (46.49%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGLNYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVD-----XXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVKS-APSGFVLLRDLRPNEPEVLSLTDXXXXXXXXXXXXXXXXXXXXXXXMAVDEEPQPPAPFEY 668
            VF+QFW+W+PL +F+SLA++PT +IGLN DLK+P+ ++ S+ KPS F YP P  VP      K+  AVLS +                           +  K K   +K+ + M+VD                +F++L NPARV+PAQ K +   E  RY P K  +  G ++L+D   +  E++                              ++EP+PP PFEY
Sbjct:  765 VFTQFWFWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSIT-------------------------AKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELVE-----------------PVAAHGPKIEEEEQEPEPPEPFEY 950          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: RPN2_SCHPO (26S proteasome regulatory subunit rpn2 OS=Schizosaccharomyces pombe GN=rpn2 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.101e-21
Identity = 63/190 (33.16%), Postives = 95/190 (50.00%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGLNYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVDXXXXXXXXXXXS-------FEILINPARVVPAQEKFIKFLEDSRYVPVKSAPSGFVLLRDLRPNE-PEVLSL 548
            VF Q+WYW+PL +F+SL+FSPTALIGL+ +L  P+F F+S+ +P LF YP  +  PT  +  K+  AVLST+                         +      K++ EK+   M++D           +        E L N  RVVPAQ  +I F  + RY PV+    G ++L D   ++ P+++ L
Sbjct:  748 VFLQYWYWFPLTHFMSLSFSPTALIGLDKNLNAPKFSFISNVRPKLFAYPPKSVQPTAKTVQKVETAVLSTTVKAQARAKRAEREKASKGSNDDEMKIDK----KTTEEKEATPMEMDEEKSQDISINGNSKKEEPKSETLENFTRVVPAQLPYISFNLNGRYYPVRKFTGGVLMLIDRESDKAPDLIEL 933          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: RPN2_ASHGO (26S proteasome regulatory subunit RPN2 OS=Ashbya gossypii GN=RPN2 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.944e-18
Identity = 56/180 (31.11%), Postives = 89/180 (49.44%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGL-NYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVDXXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVK--SAPSGFVLLRDLRPNEP 533
            +F+QFWYW+PL +F+SL+F+PT  IG+ ++DLK+P+F F  H K  +F+YP         S  K+  AVLST+                        ++    + +   E D D  + +           ++  + N  RVVP Q K+I F +D R+ PV+     +G ++L D  P+EP
Sbjct:  727 MFTQFWYWFPLAHFLSLSFTPTTTIGVRSHDLKIPKFSFHCHTKEGIFDYPPMFEEDIDKSIEKVATAVLSTT-AKAKARAKKSKKDKAVEPDKSKEEIKVENEQRDKKEHDADVPEEE----FKIKYTSTYYKVENMTRVVPQQLKYIAFPKDERFTPVRKFKGSNGVIVLSDKTPDEP 901          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: RPN2_YEAST (26S proteasome regulatory subunit RPN2 OS=Saccharomyces cerevisiae GN=RPN2 PE=1 SV=4)

HSP 1 Score: 89.7373 bits (221), Expect = 3.667e-17
Identity = 52/183 (28.42%), Postives = 89/183 (48.63%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGL-NYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTSXXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVDXXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVK--SAPSGFVLLRDLRPNEPEVL 542
            +FSQFWYW+PL +F+SL+F+PT +IG+   D  +P+F+   +AK   F YP+     +     K+  AVLST+                              + +++ +   ++ + D            +++  N  R++P Q ++I F++D R+VPV+     +G V+LRD  P EP  L
Sbjct:  735 MFSQFWYWFPLAHFLSLSFTPTTVIGIRGSDQAIPKFQMNCYAKEDAFSYPRMYEEASGKEVEKVATAVLSTTARAKARAKKTKKEKGPNEEEKKKEHEEKEKERETNKKGIKETKENDEEFYKNKYSSKPYKV-DNMTRILPQQSRYISFIKDDRFVPVRKFKGNNGVVVLRDREPKEPVAL 916          
BLAST of DC900169 vs. ExPASy Swiss-Prot
Match: RPN2_CANGA (26S proteasome regulatory subunit RPN2 OS=Candida glabrata GN=RPN2 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 8.169e-17
Identity = 51/182 (28.02%), Postives = 91/182 (50.00%), Query Frame = 3
Query:    3 VFSQFWYWYPLIYFISLAFSPTALIGL-NYDLKVPRFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPAAVLSTS--XXXXXXXXXXXXXXXXXXXXXXXTDLSSAGKGKSSNEKDGDSMQVDXXXXXXXXXXXSFEILINPARVVPAQEKFIKFLEDSRYVPVK--SAPSGFVLLRDLRPNEP 533
            +F+QFWYW+P+ +F+SL+F+PT ++G+   DL +P+F+   +A+  +F YPK           K+  A+LST+                          DL      K   +K+ ++ + D             E   N +RV+P Q K+++F+++ R+ PV+     +G V+L+D +P+EP
Sbjct:  732 MFTQFWYWFPMAHFLSLSFTPTTIVGVRGSDLNIPKFDMNCYAREDVFSYPKMFEESADKEVEKVATAILSTTARAKARAKKTKKEKDTNEDDKKKKEKDLKKEETKKDDAKKESEA-EEDFNKNRYSSKPYKIE---NMSRVLPQQLKYVQFIKEERFTPVRKFKGTNGVVVLKDNKPSEP 909          
The following BLAST results are available for this feature:
BLAST of DC900169 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
PSMD1_DICDI5.644e-2633.1926S proteasome non-ATPase regulatory subunit 1 OS=... [more]
PSMD1_CHICK8.150e-2531.5826S proteasome non-ATPase regulatory subunit 1 OS=... [more]
PSMD1_RAT1.816e-2431.1426S proteasome non-ATPase regulatory subunit 1 OS=... [more]
PSMD1_MOUSE1.816e-2431.1426S proteasome non-ATPase regulatory subunit 1 OS=... [more]
PSMD1_PONAB5.282e-2431.1426S proteasome non-ATPase regulatory subunit 1 OS=... [more]
PSMD1_HUMAN5.282e-2431.1426S proteasome non-ATPase regulatory subunit 1 OS=... [more]
RPN2_SCHPO1.101e-2133.1626S proteasome regulatory subunit rpn2 OS=Schizosa... [more]
RPN2_ASHGO1.944e-1831.1126S proteasome regulatory subunit RPN2 OS=Ashbya g... [more]
RPN2_YEAST3.667e-1728.4226S proteasome regulatory subunit RPN2 OS=Saccharo... [more]
RPN2_CANGA8.169e-1728.0226S proteasome regulatory subunit RPN2 OS=Candida ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900169 VSS Citrus sinensis cDNA clone VS27V92 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900169 ID=DC900169|Name=DC900169|organism=Citrus sinensis|type=EST|length=1213bp
CTGTTTTTAGCCAGTTTTGGTATTGGTATCCCCTTATATACTTCATTAGC
TTGGCGTTTTCACCCACGGCTTTAATTGGACTCAACTATGACTTGAAAGT
TCCTCGGTTTGAATTCTTATCACATGCGAAACCTTCTCTGTTCGAATATC
CGAAACCTACCACTGTGCCCACCACCACATCAGCTGTAAAACTTCCCGCT
GCTGTTCTGTCAACTTCAGCTAAGGCCAAAGCTCGGGCTAAGAAAGAAGC
GGAGCAGAAAGAGAAAGAGAAAGCGACTGCTGAAAAGACAGATTTGTCCT
CTGCCGGAAAAGGAAAATCATCTAATGAGAAAGATGGAGACTCTATGCAG
GTTGATGCACCTCCAGAGAAGAAAGCAGAGCCTGAGCCTTCTTTCGAAAT
TTTGATTAACCCTGCCAGGGTGGTTCCAGCACAGGAGAAGTTCATTAAAT
TTCTTGAGGACAGCAGATATGTGCCTGTGAAGTCAGCACCATCAGGGTTT
GTTCTCCTGAGGGACTTGCGTCCCAATGAACCAGAGGTACTATCCCTCAC
AGATGCTCCATCGTCTACACAGTCACCTGCTGGTGGTGGGTCAACAACGG
GACAGCAGGGTTCTGCTTCGGCCATGGCTGTTGATGAAGAACCTCAGCCA
CCAGCTCCTTTCGAGTACACCTCATGATTCAGCTAGTGTGTGATTTTGAT
CCTCTGTTTTGGGAGTAGAGGTGCTACGAGCGGAAGAAACAAACAAATTG
GTCTGATTAACCGCTGCTACAATCCTGCTTGGTGAGATGAGCAACAAAGG
TTGAATTAGCAGGCNCTTTGCAGGTTCTCTGTTATCGTGAAACTGTAAAC
TGTTTTAGTTTAATTTGTATGTTTATTTTTAAAGGTGAACAGGGAAAGAT
GGAACCTGCAAATACNCTGGATCTAGGAAAGTTCTTAATCATCTTCCCTG
TAATTTAAGACATTGTTTTCNCCGAAAAAAAATCTAGACNCTGAACAGAG
CAAAAGATGTCATTCTAGATGAATTTGTTGTGTTTCTTTTGTAGTTACGT
TTAATTCGGAAGACTGGAAAGGGGAACCTCGCTCAAGCCTCCCCAGGGTT
CATGAGTTTGCAATTAGTTAACAGTATCTTGTTTAAGCATCATATTTGGT
TTTTTGTGTAATTTGCGTATTACTCTCAGTGAGCATGACATAATAGATGG
CTGCAATTTCAAT
back to top