CN186100

Overview
NameCN186100
Unique NameCN186100
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length675
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:122..796. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXD1_ARATH (Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 3.789e-90
Identity = 162/221 (73.30%), Postives = 193/221 (87.33%), Query Frame = 2
Query:   11 VPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDL-EADPKDEYL 670
            VP+ ++D EQLR AFEGWGTNE LIISILAHR+A QRK+IRQ Y +T GEDLLK+LDKEL+NDFER ++LWTL+P ERDA LANEATKRWTSSNQVLME+ACTR+S QLL ARQAYHAR+KKSLEEDV +HT GDFRKLL+ LVT+YRYEGDEVN+TLAK EAK++HEKI +K YNDED+IRIL+TRSKAQINAT N+Y++ +G +I + L E D  D++L
Sbjct:   10 VPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLEEGDDDDKFL 230          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXD2_ARATH (Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 4.199e-81
Identity = 146/219 (66.67%), Postives = 180/219 (82.19%), Query Frame = 2
Query:    5 AQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKD 661
            + VP   +D EQL KAF GWGTNE+LIISILAHRNAAQR LIR  YA T  EDLLK+LDKEL++DFER VMLWTLDP ERDA+LA E+TK +T +N VL+EIACTR + +L++ +QAY AR+KKS+EEDV  HT+GD RKLLLPLV+ +RYEGD+VN+ LA+SEAKILHEK+S K+Y+D+D IRIL TRSKAQ+ ATLN Y N YGN I+++L+ +  D
Sbjct:    8 SNVPLPEDDAEQLHKAFSGWGTNEKLIISILAHRNAAQRSLIRSVYAATYNEDLLKALDKELSSDFERAVMLWTLDPPERDAYLAKESTKMFTKNNWVLVEIACTRPALELIKVKQAYQARYKKSIEEDVAQHTSGDLRKLLLPLVSTFRYEGDDVNMMLARSEAKILHEKVSEKSYSDDDFIRILTTRSKAQLGATLNHYNNEYGNAINKNLKEESDD 226          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXD7_ARATH (Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 3.554e-80
Identity = 146/222 (65.77%), Postives = 178/222 (80.18%), Query Frame = 2
Query:    5 AQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYL 670
            A VP   ED EQL KAF+GWGTNE++IISILAHRNA QR  IR  YA    +DLLK LD+EL+ DFER VMLWT +PAERDA+LA E+TK +T +N VL+EIACTRS+ +L  A+QAY AR+K SLEEDV YHT+GD RKLL+PLV+ +RY+GDEVN+TLA+SEAKILHEKI  K Y D+DLIRIL TRSKAQI+ATLN YKN +G  + + L+ D ++EY+
Sbjct:    8 ATVPLPEEDAEQLYKAFKGWGTNERMIISILAHRNATQRSFIRAVYAANYNKDLLKELDRELSGDFERAVMLWTFEPAERDAYLAKESTKMFTKNNWVLVEIACTRSALELFNAKQAYQARYKTSLEEDVAYHTSGDIRKLLVPLVSTFRYDGDEVNMTLARSEAKILHEKIKEKAYADDDLIRILTTRSKAQISATLNHYKNNFGTSMSKYLKEDSENEYI 229          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXD6_ARATH (Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.070e-76
Identity = 142/224 (63.39%), Postives = 175/224 (78.12%), Query Frame = 2
Query:    5 AQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEG--DEVNITLAKSEAKILHEKISNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYL 670
            A +P   ED EQL KAF+GWGTNE +IISILAHRNA QR  IR  YA    +DLLK LD EL+ DFERVVMLWTLDP ERDA+LANE+TK +T +  VL+EIACTR S +  + +QAYH R+K SLEEDV YHT+G+ RKLL+PLV+ +RY+G  DEVN+ LA+SEAK LH+KI+ K Y DEDLIRIL TRSKAQINATLN +K+ +G+ I++ L+ D  D+Y+
Sbjct:    8 ANIPLPEEDSEQLHKAFKGWGTNEGMIISILAHRNATQRSFIRAVYAANYNKDLLKELDGELSGDFERVVMLWTLDPTERDAYLANESTKLFTKNIWVLVEIACTRPSLEFFKTKQAYHVRYKTSLEEDVAYHTSGNIRKLLVPLVSTFRYDGNADEVNVKLARSEAKTLHKKITEKAYTDEDLIRILTTRSKAQINATLNHFKDKFGSSINKFLKEDSNDDYV 231          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANX4_FRAAN (Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2)

HSP 1 Score: 231.876 bits (590), Expect = 2.395e-60
Identity = 116/214 (54.21%), Postives = 152/214 (71.03%), Query Frame = 2
Query:   26 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEY 667
            ED E LRK+ +GWGTNE+ IISIL HRNA QRK IR  Y     EDLLK L+ EL+ DFE+ V  WTLDPA+RDA LAN A K+ T    V++EI+C  S ++LL  R+AY  R+K S+EED+  HT GD RKLL+ LVTAYRY+G E+N  LA SEA ILH+ I +K +N E++IRIL+TRSK Q+ AT N+Y++  G  I ++L  +  +++
Sbjct:   14 EDAEALRKSVKGWGTNEKAIISILGHRNAGQRKEIRAAYEQLYQEDLLKPLESELSGDFEKAVYRWTLDPADRDAVLANVAIKKSTDVYNVIIEISCIHSPEELLAVRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILHDAIKDKAFNHEEIIRILSTRSKTQLMATFNKYRDDQGISISKNLLEEGANDF 227          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXD3_ARATH (Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 3.976e-39
Identity = 87/223 (39.01%), Postives = 131/223 (58.74%), Query Frame = 2
Query:    8 QVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLAN-----EATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKD 661
            +VPS  +D E L++A  GWGT+E+ II +L  R+ +QR+ IR+++ +  G+DL+  L  EL+ DF + V+ WT DPAERDA L N     E  K+   + +V++EI+CT S   L+  R+AY + F  SLEE +         KLL+ L + +RY+ D  +  +A  EA +L E I  K  + + ++ IL TRS  Q+  T   YK  YG  ID+D++  P D
Sbjct:    9 EVPSPAQDSETLKQAIRGWGTDEKAIIRVLGQRDQSQRRKIRESFREIYGKDLIDVLSSELSGDFMKAVVSWTYDPAERDARLVNKILNKEKKKKSLENLKVIVEISCTTSPNHLIAVRKAYCSLFDSSLEEHIASSLPFPLAKLLVTLASTFRYDKDRTDAEVATIEAAMLREAIEKKQLDHDHVLYILGTRSIYQLRETFVAYKKNYGVTIDKDVDGCPGD 231          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXD5_ARATH (Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.120e-33
Identity = 75/220 (34.09%), Postives = 125/220 (56.82%), Query Frame = 2
Query:   11 VPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNK-TYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEY 667
            VPS   D +QL KAF+G G +  +II+ILAHRNA QR LI Q Y     +DL K L  EL    ++ V+LW  +  ERDA +   + +   + ++ + EI CTRS  QL + +Q Y   F   LEED+    +G+ +++LL  +   RYEG E++    +++A+ L   ++ K   +D+ LI+I   RS+  + A  + Y+++YG ++ + +  + +  +
Sbjct:   10 VPSPRVDADQLFKAFKGRGCDTSVIINILAHRNATQRALIEQEYETKFSDDLRKRLHSELHGHLKKAVLLWMPEAVERDASILKRSLRGAVTDHKAIAEIICTRSGSQLRQIKQVYSNTFGVKLEEDIESEASGNHKRVLLAYLNTTRYEGPEIDNASVENDARTLKSAVARKHKSDDQTLIQIFTDRSRTHLVAVRSTYRSMYGKELGKAIRDETRGNF 229          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXA3_MOUSE (Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3)

HSP 1 Score: 135.576 bits (340), Expect = 2.336e-31
Identity = 83/221 (37.56%), Postives = 124/221 (56.11%), Query Frame = 2
Query:   14 PSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLD 673
            PSV  D E +RKA  G GT+E+ +I+IL  R+ AQR+LI + Y     ++L   L  +L+  FE V++     PA  DA    ++ K   +    L+EI  TRSS+Q+ E  QAY+  +KKSL +D+   T+GDFRK LL L    R E  +V+  LAK +A+IL+    NK   DED    +L  RS  Q+  T ++Y+N+   DI+  ++ +    + D
Sbjct:   20 PSV--DAEAIRKAIRGLGTDEKTLINILTERSNAQRQLIVKQYQAAYEQELKDDLKGDLSGHFEHVMVALVTAPALFDANELKKSMKGTGTDEDALIEILTTRSSRQMKEISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKKDAQILYNAGENKWGTDEDKFTEVLCLRSFPQLKLTFDEYRNISQKDIEDSIKGELSGHFED 238          

HSP 2 Score: 75.8702 bits (185), Expect = 2.197e-13
Identity = 56/227 (24.67%), Postives = 96/227 (42.29%), Query Frame = 2
Query:   29 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDA--------------FLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEY 667
            D  +L+K+ +G GT+E  +I IL  R++ Q K I Q Y     + L   +  E + DF + ++  TL    RD                L N    +W +      E+ C RS  QL      Y    +K +E+ +    +G F  LLL +V   R              A+ LH+ +     ++  L RI+ +RS+  +    +++K  YG  +   +++D   +Y
Sbjct:   95 DANELKKSMKGTGTDEDALIEILTTRSSRQMKEISQAYYTVYKKSLGDDISSETSGDFRKALL--TLADGRRDESLKVDEHLAKKDAQILYNAGENKWGTDEDKFTEVLCLRSFPQLKLTFDEYRNISQKDIEDSIKGELSGHFEDLLLAIVHCAR--------NTPAFLAERLHQALKGAGTDEFTLNRIMVSRSEIDLLDIRHEFKKHYGYSLYSAIQSDTSGDY 311          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXD4_ARATH (Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.797e-31
Identity = 78/220 (35.45%), Postives = 124/220 (56.36%), Query Frame = 2
Query:   11 VPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDK-------ELTNDFER---VVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISN---KTYNDEDLIRILATRSKAQINATLNQYKNVYGNDI 631
            +P   E   +   A  G G +E  +IS L       RKL R+       ED  ++ +K        L  +F R    V++W + P ERDA L  +A K+   +  +++E++CTRS++ LL AR+AYH+ F +S+EED+  H +G  RKLL+ LV+AYRYEG++V    AKS+AKIL E +++   +    ++++RIL TRSK  +      +  + G+D+
Sbjct:    3 LPLELESLTEAISAGMGMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEKCHDHFVRHLKLEFSRFNTAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHVHGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAEAVASSGEEAVEKDEVVRILTTRSKLHLQHLYKHFNEIKGSDL 222          
BLAST of CN186100 vs. ExPASy Swiss-Prot
Match: ANXA3_HUMAN (Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3)

HSP 1 Score: 134.035 bits (336), Expect = 6.797e-31
Identity = 81/221 (36.65%), Postives = 127/221 (57.47%), Query Frame = 2
Query:   14 PSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLD 673
            PSV  D E ++KA  G GT+E+++ISIL  R+ AQR+LI + Y    G++L   L  +L+  FE +++     PA  DA    ++ K   ++   L+EI  TR+S+Q+ +  QAY+  +KKSL +D+   T+GDFRK LL L    R E  +V+  LAK +A+IL++   N+   DED    IL  RS  Q+  T ++Y+N+   DI   ++ +    + D
Sbjct:   20 PSV--DAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFED 238          

HSP 2 Score: 74.7146 bits (182), Expect = 4.894e-13
Identity = 59/232 (25.43%), Postives = 93/232 (40.09%), Query Frame = 2
Query:   14 PSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTDGEDLLKSLDKELTNDFERVVMLWTLDPAERDA--------------FLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRKLLLPLVTAYRYEGDEVNITLAKSEAKILHEKISNKTYNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEY 667
            P    D +QL+K+ +G GTNE  +I IL  R + Q K I Q Y     + L   +  E + DF + ++  TL    RD                L      RW +      EI C RS  QL      Y    +K + + +    +G F  LLL +V   R              A+ LH  +     ++  L RI+ +RS+  +     ++K  YG  +   +++D   +Y
Sbjct:   90 PPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALL--TLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVR--------NTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDY 311          
The following BLAST results are available for this feature:
BLAST of CN186100 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXD1_ARATH3.789e-9073.30Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV... [more]
ANXD2_ARATH4.199e-8166.67Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV... [more]
ANXD7_ARATH3.554e-8065.77Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 ... [more]
ANXD6_ARATH1.070e-7663.39Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV... [more]
ANX4_FRAAN2.395e-6054.21Annexin-like protein RJ4 OS=Fragaria ananassa PE=2... [more]
ANXD3_ARATH3.976e-3939.01Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV... [more]
ANXD5_ARATH1.120e-3334.09Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV... [more]
ANXA3_MOUSE2.336e-3137.56Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3[more]
ANXD4_ARATH6.797e-3135.45Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV... [more]
ANXA3_HUMAN6.797e-3136.65Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002F21_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002F21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186100 ID=CN186100|Name=CN186100|organism=Citrus sinensis|type=EST|length=675bp
AGTAGCGCAAGTTCCATCTGTTACCGAAGACTGTGAGCAGCTCAGAAAAG
CCTTTGAAGGATGGGGAACAAACGAGCAACTGATCATATCGATACTGGCT
CACAGAAATGCTGCTCAACGCAAGTTGATTCGACAAACATATGCTGATAC
TGACGGGGAAGACCTCCTCAAGTCGCTCGATAAGGAACTCACTAATGACT
TTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCTGCTGAACGTGATGCC
TTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTCTAGCAACCAGGTTCT
TATGGAAATTGCATGCACCAGGTCTTCGAAGCAATTGCTCGAAGCAAGGC
AGGCTTATCATGCTCGGTTTAAGAAGTCCCTTGAAGAGGATGTTGGTTAT
CACACCAATGGGGACTTCCGCAAGCTTTTGCTACCCCTTGTGACTGCCTA
CCGATATGAGGGTGATGAGGTGAACATTACACTTGCAAAATCAGAAGCTA
AGATTCTCCATGAGAAGATTTCGAATAAGACTTACAATGATGAGGATCTC
ATCAGGATCTTGGCTACAAGGAGCAAAGCACAGATCAATGCGACTCTGAA
TCAATACAAGAATGTATATGGGAATGATATTGATCAGGACTTAGAGGCTG
ACCCTAAAGATGAGTACCTCGACCT
back to top