DC900168

Overview
NameDC900168
Unique NameDC900168
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length476
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1532 contig Csv1_Contig1532:625..1100. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900168 vs. ExPASy Swiss-Prot
Match: CYT12_ORYSJ (Cysteine proteinase inhibitor 12 OS=Oryza sativa subsp. japonica GN=Os01g0270100 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.147e-27
Identity = 60/85 (70.59%), Postives = 71/85 (83.53%), Query Frame = 2
Query:    2 VPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVIEDFAKFAMLLKVKRGEKEEKLNVEVHKK-EGTFHLNQMQQDQE 253
            VPVHDP V+DAA+HA+++IQQRSNSLFPY L EIV AKAEV+EDFAKF +L+K+KRG KEEK   EVHK  EG F LNQMQQ+ +
Sbjct:  161 VPVHDPVVKDAADHAVKSIQQRSNSLFPYELLEIVRAKAEVVEDFAKFDILMKLKRGNKEEKFKAEVHKNLEGAFVLNQMQQEHD 245          
BLAST of DC900168 vs. ExPASy Swiss-Prot
Match: CYT6_ARATH (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 2.716e-22
Identity = 53/85 (62.35%), Postives = 63/85 (74.12%), Query Frame = 2
Query:    2 VPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVIEDFAKFAMLLKVKRGEKEEKLNVEVHKK-EGTFHLNQMQQDQE 253
            VP  DP+V+  A  A++TIQQRSNSLFPY L E+VHAKAEV  + AK+ MLLK+KRGEKEEK  VEVHK  EG  HLN  +Q  +
Sbjct:  150 VPGDDPEVKHVAEQAVKTIQQRSNSLFPYELLEVVHAKAEVTGEAAKYNMLLKLKRGEKEEKFKVEVHKNHEGALHLNHAEQHHD 234          
BLAST of DC900168 vs. ExPASy Swiss-Prot
Match: CYT7_ARATH (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana GN=CYS7 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 1.596e-14
Identity = 37/71 (52.11%), Postives = 56/71 (78.87%), Query Frame = 2
Query:    2 VPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVIEDFAKFAMLLKVKRGEKEEKLNVEVHKKE 214
            V  ++P+VQ+AA HA++++QQ+SNSLFPY L +I+ A+A+V+E+  KF +LLK++RG K EK  VEV K +
Sbjct:  157 VSTNNPEVQEAAKHAMKSLQQKSNSLFPYKLIDIILARAKVVEERVKFELLLKLERGNKLEKFMVEVMKDQ 227          
The following BLAST results are available for this feature:
BLAST of DC900168 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CYT12_ORYSJ2.147e-2770.59Cysteine proteinase inhibitor 12 OS=Oryza sativa s... [more]
CYT6_ARATH2.716e-2262.35Cysteine proteinase inhibitor 6 OS=Arabidopsis tha... [more]
CYT7_ARATH1.596e-1452.11Cysteine proteinase inhibitor 7 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900168 VSS Citrus sinensis cDNA clone VS27V90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900168 ID=DC900168|Name=DC900168|organism=Citrus sinensis|type=EST|length=476bp
AGTTCCCGTACATGATCCTCAAGTCCAGGATGCAGCCAATCATGCTATCC
AAACCATTCAGCAAAGGTCCAACTCCCTCTTCCCTTATGTACTTCAGGAG
ATTGTTCATGCAAAAGCTGAGGTGATTGAGGATTTTGCGAAATTTGCCAT
GCTTCTGAAAGTGAAGAGGGGAGAAAAAGAGGAGAAGCTCAATGTTGAAG
TACACAAGAAGGAGGGCACATTCCATCTCAATCAAATGCAACAAGATCAA
GAGTGATTTTGGAGATCATTGCTTGTGTTTTGTAGGGAAATTTATGCTTA
TATCTTGTTCATGTTGGTAGTATTTCTGTTTATACATATCGGTAGCTGTA
TTGCTCTATCGCTACTGTTGTTCCATGTATCAGTTTCCCTAAGCTAGACC
GTTGCTGTGGTAAAAGATCTTTGATCTTCTATTTAAAATATTTCAATAAT
CGGAATCTACTATTGGAAACTTCAAA
back to top