CN186094

Overview
NameCN186094
Unique NameCN186094
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length758
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10242 contig Csv1_Contig10242:5..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP12_ORYSJ (Probable aquaporin PIP1-2 OS=Oryza sativa subsp. japonica GN=PIP1-2 PE=2 SV=3)

HSP 1 Score: 392.889 bits (1008), Expect = 1.005e-108
Identity = 196/225 (87.11%), Postives = 205/225 (91.11%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            MEGKEED  LGANKF+ERQPIGTAAQ  D KDY EPPPAPLFEPGELKSWSFYRAGIAEF+ATFLFLYI+VLTVMGV  S +KC+TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF   G Y    GGANVVA GYTKGDGLGAEI+GTF+LVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEGKEEDVRLGANKFSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVNNSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQ-KGLYETTGGGANVVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLV 224          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP12_MAIZE (Aquaporin PIP1-2 OS=Zea mays GN=PIP1-2 PE=1 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 4.223e-107
Identity = 193/226 (85.40%), Postives = 206/226 (91.15%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQ-TQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            MEGKEED  LGANKF+ERQPIGTAAQ   D KDY EPPPAPLFEPGELKSWSFYRAGIAEF+ATFLFLYI++LTVMGV KS +KC+TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRALFY++MQCLGA+CGAGVVKGF   G Y    GGANVVA GYTKGDGLGAEI+GTF+LVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEGKEEDVRLGANKFSERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYIIMQCLGAVCGAGVVKGFQ-QGLYMGNGGGANVVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLV 225          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP13_MAIZE (Aquaporin PIP1-3/PIP1-4 OS=Zea mays GN=PIP1-3 PE=2 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.229e-106
Identity = 194/229 (84.72%), Postives = 206/229 (89.96%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQT----QDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            MEGKEED  LGANKF+ERQPIGTAAQ      D KDY EPPPAPLFEPGELKSWSFYRAGIAEF+ATFLFLYI+VLTVMGV KS +KC+TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRA+FY++MQCLGAICGAGVVKGF   G Y    GGANVVA GYTKGDGLGAEI+GTF+LVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEGKEEDVRLGANKFSERQPIGTAAQGAGAGDDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITVLTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQ-QGLYMGNGGGANVVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLV 228          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP11_ORYSJ (Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica GN=PIP1-1 PE=2 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.605e-106
Identity = 192/226 (84.96%), Postives = 207/226 (91.59%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQ-TQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            MEGKEED  LGAN+++ERQPIGTAAQ   D KDY EPPPAPLFEPGELKSWSFYRAGIAEF+ATFLFLYI++LTVMGV KS++KC+TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF   G Y    GGANVVA GYTKGDGLGAEI+GTF+LVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQ-QGLYMGNGGGANVVASGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLV 225          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP2_PEA (Probable aquaporin PIP-type 7a OS=Pisum sativum GN=TRG-31 PE=2 SV=2)

HSP 1 Score: 384.415 bits (986), Expect = 3.575e-106
Identity = 192/226 (84.96%), Postives = 204/226 (90.27%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQTQDG-KDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            ME KE+D  LGANKF ERQP+G AAQ+QD  KDY EPPPAPLFEP EL SWSFYRAGIAEFIATFLFLYI+VLTVMGVV+ ++KC TVGIQGIAWAFGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRA+FYMVMQ LGAICGAGVVKGF G  ++G L GGAN VA GYTKGDGLGAEI+GTF+LVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEAKEQDVSLGANKFPERQPLGIAAQSQDEPKDYQEPPPAPLFEPSELTSWSFYRAGIAEFIATFLFLYITVLTVMGVVRESSKCKTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYMVMQVLGAICGAGVVKGFEGKQRFGDLNGGANFVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 226          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP15_ARATH (Probable aquaporin PIP1-5 OS=Arabidopsis thaliana GN=PIP1-5 PE=2 SV=2)

HSP 1 Score: 383.645 bits (984), Expect = 6.098e-106
Identity = 193/225 (85.78%), Postives = 203/225 (90.22%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            MEGKEED  +GANKF ERQPIGTAAQT+  KDY EPPPAP FEPGELKSWSFYRAGIAEFIATFLFLY++VLTVMGV ++   C++VGIQGIAWAFGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRALFY+VMQCLGAICGAGVVKGF   G Y    GGANVVAHGYTKG GLGAEI+GTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEGKEEDVNVGANKFPERQPIGTAAQTES-KDYKEPPPAPFFEPGELKSWSFYRAGIAEFIATFLFLYVTVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYIVMQCLGAICGAGVVKGFQ-PGLYQTNGGGANVVAHGYTKGSGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 223          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP14_ARATH (Probable aquaporin PIP1-4 OS=Arabidopsis thaliana GN=PIP1.4 PE=1 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 2.317e-105
Identity = 192/225 (85.33%), Postives = 202/225 (89.78%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            MEGKEED  +GANKF ERQPIGT+AQ+ D KDY EPPPAPLFEPGEL SWSFYRAGIAEFIATFLFLYI+VLTVMGV ++   C++VGIQGIAWAFGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRA+FYM+MQCLGAICGAGVVKGF     Y  L GGAN VAHGYTKG GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEGKEEDVRVGANKFPERQPIGTSAQSTD-KDYKEPPPAPLFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPT-PYQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 223          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP15_MAIZE (Aquaporin PIP1-5 OS=Zea mays GN=PIP1-5 PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 3.952e-105
Identity = 191/225 (84.89%), Postives = 202/225 (89.78%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            MEGKEED  LGAN+++ERQPIGTAAQ  + KDY EPPPAPLFE  EL SWSFYRAGIAEF+ATFLFLYIS+LTVMGV KS++KC+TVGIQGIAW+FGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGF   G Y    GGAN V  GYTKGDGLGAEI+GTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEGKEEDVRLGANRYSERQPIGTAAQGTEEKDYKEPPPAPLFEAEELTSWSFYRAGIAEFVATFLFLYISILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQ-EGLYMGAGGGANAVNPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 224          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP1_SOLLC (Probable aquaporin PIP-type pTOM75 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 5.162e-105
Identity = 191/224 (85.27%), Postives = 203/224 (90.62%), Query Frame = 2
Query:   86 EGKEEDALLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            E KEED  LGANKF E QP+GTAAQT   KDY EPPPAPLFEPGEL SWSFYRAGIAEF+ATFLFLYI++LTVMG+ +S++ CS+VGIQG+AWAFGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRA+FYMVMQCLGAICGAGVVKGFM  G Y RL GGANVV  GYTKGDGLGAEIIGTFVLVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLV
Sbjct:    3 ENKEEDVKLGANKFRETQPLGTAAQTD--KDYKEPPPAPLFEPGELSSWSFYRAGIAEFMATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFM-VGPYQRLGGGANVVNPGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLV 223          
BLAST of CN186094 vs. ExPASy Swiss-Prot
Match: PIP13_ARATH (Aquaporin PIP1-3 OS=Arabidopsis thaliana GN=PIP1-3 PE=1 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 1.962e-104
Identity = 191/225 (84.89%), Postives = 200/225 (88.89%), Query Frame = 2
Query:   83 MEGKEEDALLGANKFAERQPIGTAAQTQDGKDYVEPPPAPLFEPGELKSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSNTKCSTVGIQGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMGAGQYGRLAGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 757
            MEGKEED  +GANKF ERQPIGT+AQT   KDY EPPPAP FEPGEL SWSFYRAGIAEFIATFLFLYI+VLTVMGV ++   C++VGIQGIAWAFGGMIF LVYCTAGISGGHINPAVT GLFLARKLSLTRA+FY+VMQCLGAICGAGVVKGF     Y  L GGAN VAHGYTKG GLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV
Sbjct:    1 MEGKEEDVRVGANKFPERQPIGTSAQTD--KDYKEPPPAPFFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQ-PNPYQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLV 222          
The following BLAST results are available for this feature:
BLAST of CN186094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
PIP12_ORYSJ1.005e-10887.11Probable aquaporin PIP1-2 OS=Oryza sativa subsp. j... [more]
PIP12_MAIZE4.223e-10785.40Aquaporin PIP1-2 OS=Zea mays GN=PIP1-2 PE=1 SV=1[more]
PIP13_MAIZE1.229e-10684.72Aquaporin PIP1-3/PIP1-4 OS=Zea mays GN=PIP1-3 PE=2... [more]
PIP11_ORYSJ1.605e-10684.96Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica G... [more]
PIP2_PEA3.575e-10684.96Probable aquaporin PIP-type 7a OS=Pisum sativum GN... [more]
PIP15_ARATH6.098e-10685.78Probable aquaporin PIP1-5 OS=Arabidopsis thaliana ... [more]
PIP14_ARATH2.317e-10585.33Probable aquaporin PIP1-4 OS=Arabidopsis thaliana ... [more]
PIP15_MAIZE3.952e-10584.89Aquaporin PIP1-5 OS=Zea mays GN=PIP1-5 PE=2 SV=1[more]
PIP1_SOLLC5.162e-10585.27Probable aquaporin PIP-type pTOM75 OS=Solanum lyco... [more]
PIP13_ARATH1.962e-10484.89Aquaporin PIP1-3 OS=Arabidopsis thaliana GN=PIP1-3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002F18_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002F18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186094 ID=CN186094|Name=CN186094|organism=Citrus sinensis|type=EST|length=758bp
GGGCTGCGGCCCCACATAACGGCCACAACAAAAAAGCAGTGCTTCTTATT
GACTGTTTTGTGCTTTTGAGGGACTAGCAGAAATGGAAGGTAAAGAAGAG
GATGCCTTACTGGGAGCCAACAAGTTCGCCGAGAGGCAGCCGATTGGGAC
GGCGGCTCAGACCCAAGATGGGAAGGACTACGTTGAGCCCCCACCGGCGC
CGCTCTTTGAGCCCGGCGAGCTCAAGTCTTGGTCGTTTTACAGGGCCGGT
ATAGCCGAGTTCATAGCCACTTTTCTTTTCTTGTACATCTCCGTACTGAC
AGTGATGGGCGTCGTCAAGTCCAATACCAAGTGCTCAACCGTCGGCATTC
AAGGGATTGCATGGGCCTTCGGTGGCATGATCTTCGTGCTCGTTTACTGC
ACAGCTGGCATCTCGGGTGGTCATATCAACCCGGCGGTGACACTCGGCCT
GTTCTTGGCGAGGAAGCTGTCGCTGACACGTGCACTTTTCTACATGGTGA
TGCAGTGTCTGGGAGCCATCTGCGGTGCTGGCGTTGTAAAGGGTTTCATG
GGTGCCGGCCAATACGGGCGGCTCGCCGGCGGTGCCAACGTCGTAGCTCA
TGGCTACACCAAGGGTGATGGTCTTGGTGCCGAGATTATTGGTACTTTTG
TTCTTGTCTACACAGTTTTCTCTGCCACTGATGCCAAACGGAGCGCCAGG
GACTCTCATGTTCCTATTTTGGCTCCTCTGCCAATTGGGTTCGCTGTGTT
TTTGGTTC
back to top