CN186082

Overview
NameCN186082
Unique NameCN186082
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length734
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10238 contig Csv1_Contig10238:699..1432. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG7_ARATH (Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2)

HSP 1 Score: 416.387 bits (1069), Expect = 7.997e-116
Identity = 196/211 (92.89%), Postives = 206/211 (97.63%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAGT 639
            NLLVDPLTHQV ICDFGSAKQL+ GEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRP PPLFNFKQE++G+SPELVNKLIPDH+KRQLGL+FL+ +GT
Sbjct:  170 NLLVDPLTHQVKICDFGSAKQLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSGT 380          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG6_ARATH (Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=1 SV=2)

HSP 1 Score: 399.438 bits (1025), Expect = 1.012e-110
Identity = 189/210 (90.00%), Postives = 200/210 (95.24%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAG 636
            NLLVDPLTHQ  +CDFGSAK L+ GEANISYICSR+YRAPELIFGATEYT+SIDIWSAGCVLAELLLGQPLFPGEN+VDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFF+ELREPNARLPNGRPLPPLFNFKQELSGASPEL+N+LIP+HV+RQ+   F   AG
Sbjct:  202 NLLVDPLTHQCKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTSSIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEHVRRQMNGGFPFQAG 411          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG9_ARATH (Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 2.755e-108
Identity = 184/201 (91.54%), Postives = 194/201 (96.52%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQL 609
            NLLVDPLTHQV +CDFGSAK L+ GE NISYICSR+YRAPELIFGATEYT SIDIWSAGCVLAELLLGQPLFPGEN+VDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFF+ELREPNARLPNGRPLPPLFNFKQEL GAS EL+N+LIP+HV+RQ+
Sbjct:  200 NLLVDPLTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTASIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQELGGASMELINRLIPEHVRRQM 400          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG5_ARATH (Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 8.314e-97
Identity = 166/201 (82.59%), Postives = 184/201 (91.54%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPELVNKLIPDHVKRQ 606
            NLLV+P THQV +CDFGSAK L+ GE NISYICSR+YRAPELIFGATEYTT+IDIWSAGCVLAELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIKAHPWHK+FHKR PPEA+DL SRLLQYSP+LR TA+EA  HPFFDELR+PN RLPNGR LPPLFNFK QEL GAS EL++KLIPDH ++Q
Sbjct:  204 NLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTTIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFFDELRDPNTRLPNGRALPPLFNFKPQELKGASLELLSKLIPDHARKQ 404          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG4_ARATH (Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.852e-96
Identity = 163/208 (78.37%), Postives = 184/208 (88.46%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPELVNKLIPDHVKRQLGLNFLH 627
            NLLV+P THQ+ ICDFGSAK L+ GE NISYICSR+YRAPELIFGATEYTT+IDIWS GCV+AELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIK HPWHKVF KR+PPEA+DL  R  QYSP+LRCTA+EAC HPFFDELR+PNARLPNGRPLPPLFNFK QELSG  PE V++L+P+H ++Q     LH
Sbjct:  212 NLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLLCRFFQYSPNLRCTAVEACIHPFFDELRDPNARLPNGRPLPPLFNFKPQELSGIPPETVDRLVPEHARKQNHFMALH 419          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG10_ARATH (Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=1 SV=2)

HSP 1 Score: 349.747 bits (896), Expect = 9.192e-96
Identity = 161/208 (77.40%), Postives = 183/208 (87.98%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPELVNKLIPDHVKRQLGLNFLH 627
            NLLV+P THQ+ ICDFGSAK L+ GE N+SYICSR+YRAPELIFGA+EYTT+IDIWS GCV+AELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIK HPWHKVF KR+PPEA+DL  R  QYSP+LRCTALEAC HP FDELR+PN RLPNGRPLPPLFNFK QELSG  PE+VN+L+P+H ++Q     LH
Sbjct:  213 NLLVNPHTHQLKICDFGSAKVLVKGEPNVSYICSRYYRAPELIFGASEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLLCRFFQYSPNLRCTALEACIHPLFDELRDPNTRLPNGRPLPPLFNFKPQELSGIPPEIVNRLVPEHARKQNLFMALH 420          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG3_ARATH (Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 2.674e-95
Identity = 161/201 (80.10%), Postives = 182/201 (90.55%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPELVNKLIPDHVKRQ 606
            NLLV+P THQV +CDFGSAK L+ GE NISYICSR+YRAPELIFGATEYTT+ID+WSAGCVLAELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRC AL++  HPFFDELR+PNARLPNGR LPPLFNFK  EL G   E+V KL+P+H ++Q
Sbjct:  203 NLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHPFFDELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQ 403          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG8_ARATH (Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3)

HSP 1 Score: 347.051 bits (889), Expect = 5.958e-95
Identity = 160/197 (81.22%), Postives = 179/197 (90.86%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNF-KQELSGASPELVNKLIPDH 594
            NLLV+P THQ+ ICDFGSAK L+ GE NISYICSR+YRAPELIFGATEYT +ID+WS GCV+AELLLGQPLFPGE+ +DQLVEIIK+LGTPTREEIRCMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEACAHPFFD+LR+PN  LPNGR LPPLFNF  QEL+GAS EL  +LIP H
Sbjct:  268 NLLVNPQTHQLKICDFGSAKMLVPGEPNISYICSRYYRAPELIFGATEYTNAIDMWSGGCVMAELLLGQPLFPGESGIDQLVEIIKILGTPTREEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACAHPFFDDLRDPNVSLPNGRALPPLFNFTAQELAGASTELRQRLIPAH 464          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: MSK1_TOBAC (Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.327e-94
Identity = 162/201 (80.60%), Postives = 180/201 (89.55%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPELVNKLIPDHVKRQ 606
            NLLV+P THQV +CDFGSAK L+ GE NISYICSR+YRAPELIFGATEYTT+IDIWSAGCVLAELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNY +F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEA  H FFDELR+PN RLPNGR LPPLFNFK  EL G S E + KL+P+H ++Q
Sbjct:  203 NLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEAVTHAFFDELRDPNTRLPNGRVLPPLFNFKAHELKGVSAENLLKLVPEHARKQ 403          
BLAST of CN186082 vs. ExPASy Swiss-Prot
Match: KSG1_ARATH (Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=2 SV=3)

HSP 1 Score: 343.584 bits (880), Expect = 6.587e-94
Identity = 160/201 (79.60%), Postives = 180/201 (89.55%), Query Frame = 1
Query:    7 NLLVDPLTHQVNICDFGSAKQLIAGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPELVNKLIPDHVKRQ 606
            NLLV+P THQV +CDFGSAK L+ GE NISYICSR+YRAPELIFGATEYTT+ID+WSAGCVLAELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LR  AL+   HPFFDELR+PNARLPNGR LPPLFNFK  EL G   E+V KL+P+H ++Q
Sbjct:  199 NLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFFDELRDPNARLPNGRFLPPLFNFKPHELKGVPLEMVAKLVPEHARKQ 399          
The following BLAST results are available for this feature:
BLAST of CN186082 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
KSG7_ARATH7.997e-11692.89Shaggy-related protein kinase eta OS=Arabidopsis t... [more]
KSG6_ARATH1.012e-11090.00Shaggy-related protein kinase zeta OS=Arabidopsis ... [more]
KSG9_ARATH2.755e-10891.54Shaggy-related protein kinase iota OS=Arabidopsis ... [more]
KSG5_ARATH8.314e-9782.59Shaggy-related protein kinase epsilon OS=Arabidops... [more]
KSG4_ARATH1.852e-9678.37Shaggy-related protein kinase delta OS=Arabidopsis... [more]
KSG10_ARATH9.192e-9677.40Shaggy-related protein kinase kappa OS=Arabidopsis... [more]
KSG3_ARATH2.674e-9580.10Shaggy-related protein kinase gamma OS=Arabidopsis... [more]
KSG8_ARATH5.958e-9581.22Shaggy-related protein kinase theta OS=Arabidopsis... [more]
MSK1_TOBAC1.327e-9480.60Shaggy-related protein kinase NtK-1 OS=Nicotiana t... [more]
KSG1_ARATH6.587e-9479.60Shaggy-related protein kinase alpha OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002F10_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002F10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186082 ID=CN186082|Name=CN186082|organism=Citrus sinensis|type=EST|length=734bp
AGTGTAAACCTTTTGGTTGATCCTCTTACTCACCAGGTTAACATTTGTGA
TTTTGGAAGTGCAAAACAGCTGATTGCTGGAGAAGCAAACATATCATACA
TATGTTCACGTTTCTATCGGGCTCCAGAACTTATATTTGGAGCTACAGAA
TATACAACCTCAATTGATATATGGTCAGCTGGTTGTGTGCTTGCCGAGCT
TCTTTTGGGCCAGCCATTATTTCCTGGAGAAAATGCAGTGGACCAGCTTG
TAGAGATTATCAAGGTTCTCGGTACACCCACTCGTGAAGAAATTCGCTGT
ATGAATCCAAATTATACCGATTTTAGGTTTCCACAGATTAAAGCACATCC
TTGGCACAAGGTTTTCCACAAACGGATGCCTCCTGAGGCTATTGATCTTG
CTTCACGCCTGTTGCAGTATTCACCAAGTCTCCGATGTACAGCGCTAGAA
GCATGTGCACATCCTTTCTTTGATGAACTGCGTGAGCCAAATGCTCGCCT
ACCAAATGGCCGCCCACTGCCACCTCTCTTCAACTTTAAACAGGAATTAT
CGGGGGCTTCACCAGAGCTTGTTAATAAGTTGATACCAGACCATGTGAAA
CGGCAATTAGGTCTGAATTTCTTGCATCCAGCCGGGACATAGGTCTAGAC
AAGTAATATAGAAGTGAAATCTACTTGGTGATGTGTAGCACAAAGGGAAT
TATATCCTTGTTCGTAACTGCCATGCATTGAGGC
back to top